KEGG   Homo sapiens (human): 3978Help
Entry
3978              CDS       T01001                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
hsa03410  Base excision repair
hsa03420  Nucleotide excision repair
hsa03430  Mismatch repair
Disease
H00094  Immunodeficiency associated with DNA repair defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    3978 (LIG1)
   03410 Base excision repair
    3978 (LIG1)
   03420 Nucleotide excision repair
    3978 (LIG1)
   03430 Mismatch repair
    3978 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    3978 (LIG1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    3978 (LIG1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     3978 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     3978 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     3978 (LIG1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    3978 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     3978 (LIG1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     3978 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     3978 (LIG1)
   MMR (mismatch excision repair)
    Other MMR factors
     3978 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DUF1685
Motif
Other DBs
NCBI-GeneID: 3978
NCBI-ProteinID: NP_000225
OMIM: 126391
HGNC: 6598
Ensembl: ENSG00000105486
Vega: OTTHUMG00000183187
Pharos: P18858(Tchem)
UniProt: P18858
LinkDB All DBs
Structure
PDB: 

Position
19q13.33
AA seq 919 aa AA seqDB search
MQRSIMSFFHPKKEGKAKKPEKEASNSSRETEPPPKAALKEWNGVVSESDSPVKRPGRKA
ARVLGSEGEEEDEALSPAKGQKPALDCSQVSPPRPATSPENNASLSDTSPMDSSPSGIPK
RRTARKQLPKRTIQEVLEEQSEDEDREAKRKKEEEEEETPKESLTEAEVATEKEGEDGDQ
PTTPPKPLKTSKAETPTESVSEPEVATKQELQEEEEQTKPPRRAPKTLSSFFTPRKPAVK
KEVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDACWKPGQKVPYLAVARTFEKIE
EVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVGDGVLLKAVAQ
ATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRDIARLTGSAST
AKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLTPPGQEFPPAM
VDAGKGKTAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPEHCKLSPGIPL
KPMLAHPTRGISEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRNQEDNTGKYPD
IISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF
DLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDIEQIAEFLEQSVKDSCE
GLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGKRAGRYGGFLL
ASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAVIPDHWLDPSA
VWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTSAQVACLYRKQ
SQIQNQQGEDSGSDPEDTY
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgaagtatcatgtcatttttccaccccaagaaagagggtaaagcaaagaagcct
gagaaggaggcatccaatagcagcagagagacggagccccctccaaaggcggcactgaag
gagtggaatggagtggtgtccgagagtgactctccggtgaagaggccagggaggaaggcg
gcccgggtcctgggcagcgaaggggaagaggaggatgaagcccttagccctgctaaaggc
cagaagcctgccctggactgctcacaggtctccccgccccgtcctgccacatctcctgag
aacaatgcttccctctctgacacctctcccatggacagttccccatcagggattccgaag
cgtcgcacagctcggaagcagctcccgaaacggaccattcaggaagtcctggaagagcag
agtgaggacgaggacagagaagccaagaggaagaaggaggaggaagaagaggagaccccg
aaagaaagcctcacagaggctgaagtggccacagagaaggaaggagaagacggggaccag
cccaccacgcctcccaagcccctaaagacctccaaagcagagaccccgacggaaagcgtt
tcagagcctgaggtggccacgaagcaggaactgcaggaggaggaagagcagaccaagcct
ccccgcagagctcccaagacgctcagcagcttcttcaccccccggaagccagcagtcaaa
aaagaagtgaaggaagaggagccaggggctccaggaaaggagggagctgctgagggaccc
ctggatccatctggttacaatcctgccaagaacaactatcatcccgtggaagatgcctgc
tggaaaccgggccagaaggttccttacctggctgtggcccggacgtttgagaagatcgag
gaggtgtctgctcggctccggatggtggagacgctgagcaacttgctgcgctccgtggtg
gccctgtcgcctccagacctcctccctgtcctctacctcagcctcaaccaccttgggcca
ccccagcagggcctggagcttggcgtgggtgatggtgtccttctcaaggcagtggcccag
gccacaggtcggcagctggagtccgtccgggctgaggcagccgagaaaggcgacgtgggg
ctggtggccgagaacagccgcagcacccagaggctcatgctgccaccacctccgctcact
gcctccggggtcttcagcaagttccgcgacatcgccaggctcactggcagtgcttccaca
gccaagaagatagacatcatcaaaggcctctttgtggcctgccgccactcagaagcccgg
ttcatcgctaggtccctgagcggacggctgcgccttgggctggcagagcagtcggtgctg
gctgccctctcccaggcagtgagcctcacgcccccgggccaagaattcccaccagccatg
gtggatgctgggaagggcaagacagcagaggccagaaagacgtggctggaggagcaaggc
atgatcctgaagcagacgttctgcgaggttcccgacctggaccgaattatccccgtgctg
ctggagcacggcctggaacgtctcccggagcactgcaagctgagcccagggattcccctg
aaaccaatgttggcccatcccacccggggcatcagcgaggtcctgaaacgctttgaggag
gcagctttcacctgcgaatacaaatatgacgggcagagggcacagatccacgccctggaa
ggcggggaggtgaagatcttcagcaggaatcaggaagacaacactgggaagtacccggac
atcatcagccgcatccccaagattaaactcccatcggtcacatccttcatcctggacacc
gaagccgtggcttgggaccgggaaaagaagcagatccagccattccaagtgctcaccacc
cgcaaacgcaaggaggtggatgcgtctgagatccaggtgcaggtgtgtttgtacgccttc
gacctcatctacctcaatggagagtccctggtacgtgagcccctttcccggcgccggcag
ctgctccgggagaactttgtggagacagagggcgagtttgtcttcgccacctccctggac
accaaggacatcgagcagatcgccgagttcctggagcagtcagtgaaagactcctgcgag
gggctgatggtgaagaccctggatgttgatgccacctacgagatcgccaagagatcgcac
aactggctcaagctgaagaaggactaccttgatggcgtgggtgacaccctggacctggtg
gtgatcggcgcctacctgggccgggggaagcgggccggccggtacgggggcttcctgctg
gcctcctacgacgaggacagtgaggagctgcaggccatatgcaagcttggaactggcttc
agtgatgaggagctggaggagcatcaccagagcctcaaggcgctggtgctgcccagccca
cgcccttacgtgcggatagatggcgctgtgattcccgaccactggctggaccccagcgct
gtgtgggaggtgaagtgcgctgacctctccctctctcccatctaccctgctgcgcggggc
ctggtggatagtgacaagggcatctcccttcgcttccctcggtttattcgagtccgtgaa
gacaagcagccggagcaggccaccaccagtgctcaggtggcctgtttgtaccggaagcaa
agtcagattcagaaccaacaaggcgaggactcaggctctgaccctgaagatacctactaa

DBGET integrated database retrieval system