KEGG   Homo sapiens (human): 399909
Entry
399909            CDS       T01001                                 

Gene name
PCNX3, PCNXL3
Definition
(RefSeq) pecanex 3
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Pecanex_C
Other DBs
NCBI-GeneID: 399909
NCBI-ProteinID: NP_115599
OMIM: 617657
HGNC: 18760
Ensembl: ENSG00000197136
Vega: OTTHUMG00000166539
Pharos: Q9H6A9(Tdark)
UniProt: Q9H6A9
LinkDB
Position
11q13.1
AA seq 2034 aa
MGSQVLQILRQGVWASLTGGWFFDPHQSTFSNCFHLYVWIFLLIFPFLLYMVLPPSLMVA
GVYCLVVAVIFATIKTVNYRLHAMFDQGEIVEKRSSTMGELEEEPAQGDSNPPRDPGVEM
TVFRKVSSTPPVRCSSQHSVFGFNQVSELLPRMEDSGPLRDIKELVREQGSNNVIVTSAD
REMLKLSSQEKLIGDLPQTPPGAVPDPSLASTDSSEPSPLAGDGAPWSGSSMADTPMSPL
LKGSLSQELSKSFLTLTQPDRALVRTSSRREQRRGAGGYQPLDRRGSGEPTPQKAGSSDS
CFSGTDRETLSSFKSEKTNSTHLDSPPGGPAPEGSDTDPPSEAELPASPDAGVPSDDTLR
SFDTVIGAGTPPGLAEPLLVVRPKDLALLRPSKRQPPLRRHSPPGRAPRRPLLEGGGFFE
DEDTSEGSELSPASSLRSQRRYSTDSSSSTSCYSPESSRGAAGGPRKRRAPHGAEEGTAV
PPKRPYGTQRTPSTASAKTHARVLSMDGAGGDVLRPPLAGCKAELEAQVGVEQAASEPVV
LPAEARRGPAANQPGWRGELQEEGAVGGAAEETGRRDRSSSVRRTQAIRRRHNAGSNPTP
PASVMGSPPSSLQEAQRGRAASHSRALTLPSALHFASSLLLTRAGANVHEACTFDDTSEG
AVHYFYDESGVRRSYTFGLAGGGYENPVGQQGEQTANGAWDRHSHSSSFHSADVPEATGG
LNLLQPRPVVLQGMQVRRVPLEIPEEQTLMEEAPPRAQHSYKYWLLPGRWTSVRYERLAL
LALLDRTRGVLENIFGVGLSSLVAFLGYLLLLKGFFTDIWVFQFCLVIASCQYSLLKSVQ
PDAASPMHGHNWVIAYSRPVYFCICCLLIWLLDALGSAQPFPPVSLYGLTLFSASFFFCA
RDVATVFTLCFPFVFLLGLLPQVNTCLMYLLEQIDMHGFGGTAATSPLTAVFSLSRSLLA
AALLYGFCLGAIKTPWPEQHVPVLFSVFCGLLVALSYHLSRQSSDPTVLWSLIRSKLFPE
LEERSLETARAEPPDPLPDKMRQSVREVLHSDLVMCVVIAVLTFAISASTVFIALKSVLG
FVLYALAGAVGFFTHYLLPQLRKQLPWFCLSQPVLKPLEYSQYEVRGAAQVMWFEKLYAG
LQCVEKYLIYPAVVLNALTVDAHTVVSHPDKYCFYCRALLMTVAGLKLLRSAFCCPPQQY
LTLAFTVLLFHFDYPRLSQGFLLDYFLMSLLCSKLWDLLYKLRFVLTYIAPWQITWGSAF
HAFAQPFAVPHSAMLFVQALLSGLFSTPLNPLLGSAVFIMSYARPLKFWERDYNTKRVDH
SNTRLVTQLDRNPGADDNNLNSIFYEHLTRSLQHTLCGDLVLGRWGNYGPGDCFVLASDY
LNALVHLIEVGNGLVTFQLRGLEFRGTYCQQREVEAITEGVEEDEGCCCCEPGHLPRVLS
FNAAFGQRWLAWEVTASKYVLEGYSISDNNAASMLQVFDLRKILITYYVKSIIYYVSRSP
KLEVWLSHEGITAALRPVRVPGYADSDPTFSLSVDEDYDLRLSGLSLPSFCAVHLEWIQY
CASRRSQPVDQDWNSPLVTLCFGLCVLGRRALGTASHSMSASLEPFLYGLHALFKGDFRI
TSPRDEWVFADMDLLHRVVAPGVRMALKLHQDHFTSPDEYEEPAALYDAIAANEERLVIS
HEGDPAWRSAILSNTPSLLALRHVLDDASDEYKIIMLNRRHLSFRVIKVNRECVRGLWAG
QQQELVFLRNRNPERGSIQNAKQALRNMINSSCDQPLGYPIYVSPLTTSLAGSHPQLRAL
WGGPISLGAIAHWLLRTWERLHKGCGAGCNSGGNVDDSDCSGGGGLTSLSNNPPVAHPTP
ENTAGNGDQPLPPGPGWGPRSSLSGSGDGRPPPLLQWPPPRLPGPPPASPIPTEGPRTSR
PPGPGLLSSEGPSGKWSLGGRKGLGGSDGEPASGSPKGGTPKSQAPLDLSLSLSLSLSPD
VSTEASPPRASQDIPCLDSSAPESGTPMGALGDWPAPIEERESPAAQPLLEHQY
NT seq 6105 nt   +upstreamnt  +downstreamnt
atggggtcgcaggtgttgcagatcctgcgccagggggtgtgggcctcgctcaccggcggt
tggttcttcgacccgcaccagagcaccttctccaactgcttccacctctatgtctggatc
ttcctgctcatctttcccttcttactgtacatggtcctgcctcccagcttgatggtggcc
ggcgtgtactgcctcgtggtggctgtcatctttgctactatcaagactgtcaattatcgg
cttcatgccatgtttgaccagggcgagatcgtggagaagcgcagctctaccatgggggag
ctggaggaagagcctgcccagggggacagcaatccacccagggaccccggagtggagatg
acagtgttccggaaagtcagttccacacccccggtgcgctgcagctcccagcactctgtg
tttggcttcaaccaggtctcggagctgctgccccgaatggaggactctgggccccttaga
gacatcaaggagctggtgcgggagcagggcagcaacaatgtgatcgtgacttctgccgac
cgagagatgctgaagctcagctcgcaggagaaactgattggagaccttccccagacgcct
ccaggggctgtcccagacccctctcttgccagtacagactcttcagagccttctcccctg
gctggagatggagcgccctggagtgggagcagcatggctgacactcccatgagccccctg
ctgaaggggagcctcagccaggagctgagcaagagcttcctgaccctgacccagcctgac
cgggccctggtgaggaccagcagtcgacgggaacaacgcaggggggcaggtggctatcag
ccccttgaccggcggggctcaggggagcccacgccccagaaagccggctcctcagactcc
tgcttcagcggcactgacagggagacattgagcagcttcaagagtgagaagaccaactcc
acccatctggacagccccccaggggggccagcccctgagggcagcgacacagacccaccc
tctgaggctgagctgcctgcctcaccagacgccggggtcccctcagatgacacgctgcgt
tcctttgacacggtcattggagcagggacgccaccgggcctggctgagccgctcctggtc
gtgcggcccaaggacttggccctgctacggcctagcaaacggcagccacccctgcgaaga
cactctccacctggccgtgcccctcgacggcccctgcttgaaggtgggggcttctttgag
gatgaagacactagtgagggcagtgaactgagcccggcctccagtctccgatcgcagcgc
cgctacagtactgacagctcctcttctacttcctgctactcccctgagagctcccggggt
gcagcagggggaccccggaagcggagggccccccatggggctgaggagggaactgctgtg
ccccccaagcggccatatgggacccagcggacgcctagtaccgccagcgctaaaacacat
gcccgtgtgctgagcatggatggggctgggggtgatgttctgaggcccccactggctggc
tgcaaggcagagctggaggcccaggttggggtggagcaggctgctagtgagcctgttgtg
ctgcctgctgaggcgcgaaggggacccgctgccaaccagcccggctggcggggggagctg
caggaggaaggtgctgtggggggagcggccgaggagactggcaggcgggaccgctcaagc
agtgtgaggcggacccaggccattcggagacgccacaatgcaggcagcaaccccacccct
ccagcctctgtcatgggctcgccgcccagcagcctgcaggaagctcagcggggccgggct
gcctcccactcccgggcgctgacgctgccctctgcgctgcatttcgcctcttcactgttg
ctcacccgggccggtgccaatgtgcatgaggcctgcacctttgatgacacttctgagggt
gctgtgcactatttctacgatgagagcggtgtgcggcgttcctacacctttggcctggct
ggaggcggctacgagaaccctgtagggcagcaaggggagcagacagctaatggagcctgg
gaccgacactcgcattcctccagcttccactcggctgatgtccctgaggctacaggcggc
ctgaacctgctgcagccgaggcctgtggttctgcagggcatgcaggtgcgccgggtgccc
ctggagatcccggaggagcagacactgatggaagaagcgccaccccgggcccagcatagt
tacaagtactggcttctccctggccgctggacctctgtgcgctatgagcggcttgccctg
ctggctctgctggaccggacgcggggagtgctggagaacatcttcggcgtgggcctgagc
agccttgtggccttcctgggctacctgctgctgctcaagggcttcttcactgacatctgg
gtcttccagttctgcctggtcatcgcctcctgccagtactccttgctgaagagcgtgcag
cctgatgcggcgtcccccatgcacggccacaactgggtgatcgcgtacagccgtcctgtc
tacttctgcatctgctgtctgctcatctggctgctggacgccctgggctcagctcagccc
ttcccacctgtctccctctacggcctcacgctcttctctgcctccttcttcttctgtgcc
cgagacgtggccactgtgttcaccctgtgcttccccttcgtcttcctcctgggcctcctg
ccccaggtcaacacctgcctcatgtacctgctggagcaaatagatatgcacggcttcggg
ggcacagctgccaccagcccgctcacggcagtcttcagcctctcccgcagcctgctggct
gctgccctgctctacggtttctgccttggggccatcaagactccgtggccagagcagcac
gtccctgtcctcttctcagtcttctgtggcctcctggtggcactgtcctaccacctgagc
cggcagagcagcgaccccaccgtgctctggtctctgatccggagcaagctgttccctgag
ctggaggagcgcagcttggagacagcccgggccgagcccccggaccccttgccggacaag
atgcgccagtcggtgcgtgaggtcttgcactccgacctggtgatgtgtgtggtgatcgcc
gtgctcaccttcgccatcagcgccagcaccgtctttattgccctgaagtcggtgctgggt
ttcgtgttgtacgcactggctggggccgtgggcttcttcacacattacctgctgccacaa
ctccgcaaacagctgccctggttctgcctgtcacagcccgtgctgaagccgctggagtac
agccagtatgaagtgcgcggtgccgcccaggtgatgtggtttgagaagctgtatgctggc
ctgcagtgcgtagagaagtacctcatctaccccgccgtggtgctcaacgccctcacggtg
gacgcccacacagtcgtcagccacccggacaagtactgcttctactgccgggcgctgctg
atgaccgtggctgggctgaagctgctgcgctcagccttctgctgccccccacagcagtac
ctgacgttggccttcaccgtcctgctcttccactttgactacccgcgcctctcccagggc
tttctgcttgactacttcctcatgtccctgctttgcagcaagctgtgggacttgctgtac
aagctgcgtttcgtgctgacctacatcgcgccctggcagatcacctggggctcggctttc
cacgcttttgcccagccgtttgccgtgccacactcggccatgctgttcgtccaggccctg
ctctcggggctcttctccacgcctctcaacccactgctaggcagtgccgtcttcatcatg
tcctacgctcggcccctcaagttctgggagcgcgactacaacactaaacgtgtggatcat
tccaacacccgcctggtcacacagctggacaggaaccctggcgctgatgacaacaacctc
aactccatcttctatgagcacttgacacgttcgctgcagcacacactgtgtggggacctg
gtgctgggccgctggggcaactatggccctggtgactgcttcgtcctggcctctgactac
ctcaacgccctggtgcacctcatcgaggttggcaatggcctcgtcaccttccagctgcgt
ggccttgagttccggggcacttactgccagcagcgcgaggtggaggctatcaccgagggt
gtggaggaggacgagggctgttgctgctgtgaacctggccacctgccacgggtcctgtcc
ttcaatgctgcctttgggcagcgctggctggcttgggaggtaacagccagcaagtacgtg
ctggagggctatagcattagtgacaataatgctgcctccatgctgcaggttttcgacctc
cgcaagatcctcatcacctactatgtcaagagcatcatctactacgtgagccgctcacca
aagctggaggtgtggctcagccatgagggcatcacggcagccctgaggcctgtgcgggtg
cccggctatgccgactcggatcccaccttctcgctgagtgtggatgaggactatgacctc
cgcctgtctggcctctcgctgccctccttttgtgctgtgcacctcgagtggatccagtac
tgcgcctcccggcgcagccagcccgtggaccaggattggaactccccgctggtcacgctg
tgttttggcctgtgtgtgctgggccgccgggccctggggacagcctctcacagcatgtct
gcaagcctggagcccttcctctacggcctgcacgccctgttcaagggggattttcgcatc
acctccccacgtgacgagtgggtctttgccgacatggacctgcttcaccgcgttgtggcg
cctggggttcgcatggccctcaagcttcaccaggaccacttcacgtccccagatgaatat
gaggagccagcagccctatacgatgccattgcggccaacgaggagcggctggtcatctca
catgagggtgacccagcatggcgcagcgccatcctcagcaacacgccctccctgctggcg
ctgcgccatgtcctggatgatgcctccgacgagtacaagatcatcatgctcaaccggcgc
cacctcagcttccgagtcatcaaggtgaaccgggagtgcgtgcgcggcctgtgggccggg
cagcagcaggagctggtgttcctgcgcaaccgcaaccccgagcgtggcagcatccagaac
gccaagcaggcgcttcgcaacatgatcaactcctcctgtgaccagccgctgggctacccc
atctacgtgtcgcctctcaccacctcgctggctggcagccacccccagctacgggcactg
tggggtggccccatcagcctgggtgccattgcccactggctcctgcgcacctgggagagg
cttcacaagggctgtggcgccggctgcaatagtggcgggaacgtggatgattcagactgt
agtgggggcggtggcctgacctccctcagcaataacccccccgtggcacaccccacacct
gagaacacggcaggcaatggtgaccaacccctcccaccaggccctggctgggggccgcgg
tcctccctgagtggctctggtgatgggcggcccccacctctgctgcagtggcctccccct
cggctccctggaccaccccctgcatcgcctatccccacagagggtccccggacctcacgg
ccccctggcccgggtctcctcagttctgagggccccagtggaaagtggagcctggggggc
cggaaggggctgggaggatctgacggggagccagcctcagggagccccaaaggaggtacc
cccaaatctcaggcgcctctagacctcagcctcagcctcagcctcagcctcagccccgat
gtcagcactgaggcctcaccccccagagcttcccaggacattccttgcttggacagcagt
gcccctgagagtggcacacctatgggtgccctgggcgactggcctgcccctattgaggag
cgtgagagcccggcagcccagcccctgctggaacaccagtactga

DBGET integrated database retrieval system