KEGG   Homo sapiens (human): 4000Help
Entry
4000              CDS       T01001                                 

Gene name
LMNA, CDCD1, CDDC, CMD1A, CMT2B1, EMD2, FPL, FPLD, FPLD2, HGPS, IDC, LDP1, LFP, LGMD1B, LMN1, LMNC, LMNL1, MADA, PRO1
Definition
(RefSeq) lamin A/C
  KO
K12641  lamin A/C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04210  Apoptosis
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
hsa05414  Dilated cardiomyopathy (DCM)
Network
N00328  ZMPSTE24-catalyzed cleavage of prelimin A
N00329  Mutation-caused aberrant LMNA to ZMPSTE24-catalyzed cleavage
Disease
H00264  Charcot-Marie-Tooth disease (CMT)
H00294  Dilated cardiomyopathy (DCM)
H00420  Familial partial lipodystrophy (FPL)
H00563  Emery-Dreifuss muscular dystrophy
H00590  Congenital muscular dystrophies (CMD/MDC)
H00593  Limb-girdle muscular dystrophy (LGMD)
H00601  Hutchinson-Gilford progeria syndrome
H00663  Restrictive dermopathy
H00665  Mandibuloacral dysplasia
H01216  Left ventricular noncompaction (LVNC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    4000 (LMNA)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    4000 (LMNA)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    4000 (LMNA)
   05414 Dilated cardiomyopathy (DCM)
    4000 (LMNA)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type V: Nuclear lamins
     4000 (LMNA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Filament LTD Reo_sigmaC Fez1 TPR_MLP1_2 HAUS-augmin3 IncA ATG16 CENP-F_leu_zip Tht1
Motif
Other DBs
NCBI-GeneID: 4000
NCBI-ProteinID: NP_733821
OMIM: 150330
HGNC: 6636
Ensembl: ENSG00000160789
Vega: OTTHUMG00000013961
Pharos: P02545(Tbio)
UniProt: P02545
LinkDB All DBs
Structure
PDB: 

Position
1q22
AA seq 664 aa AA seqDB search
METPSQRRATRSGAQASSTPLSPTRITRLQEKEDLQELNDRLAVYIDRVRSLETENAGLR
LRITESEEVVSREVSGIKAAYEAELGDARKTLDSVAKERARLQLELSKVREEFKELKARN
TKKEGDLIAAQARLKDLEALLNSKEAALSTALSEKRTLEGELHDLRGQVAKLEAALGEAK
KQLQDEMLRRVDAENRLQTMKEELDFQKNIYSEELRETKRRHETRLVEIDNGKQREFESR
LADALQELRAQHEDQVEQYKKELEKTYSAKLDNARQSAERNSNLVGAAHEELQQSRIRID
SLSAQLSQLQKQLAAKEAKLRDLEDSLARERDTSRRLLAEKEREMAEMRARMQQQLDEYQ
ELLDIKLALDMEIHAYRKLLEGEEERLRLSPSPTSQRSRGRASSHSSQTQGGGSVTKKRK
LESTESRSSFSQHARTSGRVAVEEVDEEGKFVRLRNKSNEDQSMGNWQIKRQNGDDPLLT
YRFPPKFTLKAGQVVTIWAAGAGATHSPPTDLVWKAQNTWGCGNSLRTALINSTGEEVAM
RKLVRSVTVVEDDEDEDGDDLLHHHHGSHCSSSGDPAEYNLRSRTVLCGTCGQPADKASA
SGSGAQVGGPISSGSSASSVTVTRSYRSVGGSGGGSFGDNLVTRSYLLGNSSPRTQSPQN
CSIM
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggagaccccgtcccagcggcgcgccacccgcagcggggcgcaggccagctccactccg
ctgtcgcccacccgcatcacccggctgcaggagaaggaggacctgcaggagctcaatgat
cgcttggcggtctacatcgaccgtgtgcgctcgctggaaacggagaacgcagggctgcgc
cttcgcatcaccgagtctgaagaggtggtcagccgcgaggtgtccggcatcaaggccgcc
tacgaggccgagctcggggatgcccgcaagacccttgactcagtagccaaggagcgcgcc
cgcctgcagctggagctgagcaaagtgcgtgaggagtttaaggagctgaaagcgcgcaat
accaagaaggagggtgacctgatagctgctcaggctcggctgaaggacctggaggctctg
ctgaactccaaggaggccgcactgagcactgctctcagtgagaagcgcacgctggagggc
gagctgcatgatctgcggggccaggtggccaagcttgaggcagccctaggtgaggccaag
aagcaacttcaggatgagatgctgcggcgggtggatgctgagaacaggctgcagaccatg
aaggaggaactggacttccagaagaacatctacagtgaggagctgcgtgagaccaagcgc
cgtcatgagacccgactggtggagattgacaatgggaagcagcgtgagtttgagagccgg
ctggcggatgcgctgcaggaactgcgggcccagcatgaggaccaggtggagcagtataag
aaggagctggagaagacttattctgccaagctggacaatgccaggcagtctgctgagagg
aacagcaacctggtgggggctgcccacgaggagctgcagcagtcgcgcatccgcatcgac
agcctctctgcccagctcagccagctccagaagcagctggcagccaaggaggcgaagctt
cgagacctggaggactcactggcccgtgagcgggacaccagccggcggctgctggcggaa
aaggagcgggagatggccgagatgcgggcaaggatgcagcagcagctggacgagtaccag
gagcttctggacatcaagctggccctggacatggagatccacgcctaccgcaagctcttg
gagggcgaggaggagaggctacgcctgtcccccagccctacctcgcagcgcagccgtggc
cgtgcttcctctcactcatcccagacacagggtgggggcagcgtcaccaaaaagcgcaaa
ctggagtccactgagagccgcagcagcttctcacagcacgcacgcactagcgggcgcgtg
gccgtggaggaggtggatgaggagggcaagtttgtccggctgcgcaacaagtccaatgag
gaccagtccatgggcaattggcagatcaagcgccagaatggagatgatcccttgctgact
taccggttcccaccaaagttcaccctgaaggctgggcaggtggtgacgatctgggctgca
ggagctggggccacccacagcccccctaccgacctggtgtggaaggcacagaacacctgg
ggctgcgggaacagcctgcgtacggctctcatcaactccactggggaagaagtggccatg
cgcaagctggtgcgctcagtgactgtggttgaggacgacgaggatgaggatggagatgac
ctgctccatcaccaccacggctcccactgcagcagctcgggggaccccgctgagtacaac
ctgcgctcgcgcaccgtgctgtgcgggacctgcgggcagcctgccgacaaggcatctgcc
agcggctcaggagcccaggtgggcggacccatctcctctggctcttctgcctccagtgtc
acggtcactcgcagctaccgcagtgtggggggcagtgggggtggcagcttcggggacaat
ctggtcacccgctcctacctcctgggcaactccagcccccgaacccagagcccccagaac
tgcagcatcatgtaa

DBGET integrated database retrieval system