KEGG   Homo sapiens (human): 4005Help
Entry
4005              CDS       T01001                                 

Gene name
LMO2, LMO-2, RBTN2, RBTNL1, RHOM2, TTG2
Definition
(RefSeq) LIM domain only 2
  KO
K15612  rhombotin-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
N00121  LMO2-rearrangement to transcriptional activation
N00122  LMO2-rearrangement to transcriptional repression
Disease
H00002  T-cell acute lymphoblastic leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    4005 (LMO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM C1_4 TDH
Motif
Other DBs
NCBI-GeneID: 4005
NCBI-ProteinID: NP_001135787
OMIM: 180385
HGNC: 6642
Ensembl: ENSG00000135363
Vega: OTTHUMG00000157176
Pharos: P25791(Tbio)
UniProt: P25791
LinkDB All DBs
Structure
PDB: 

Position
11p13
AA seq 158 aa AA seqDB search
MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLC
GCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECF
KCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcggccatcgaaaggaagagcctggacccttcagaggaaccagtggatgaggtg
ctgcagatccccccatccctgctgacatgcggcggctgccagcagaacattggggaccgc
tacttcctgaaggccatcgaccagtactggcacgaggactgcctgagctgcgacctctgt
ggctgccggctgggtgaggtggggcggcgcctctactacaaactgggccggaagctctgc
cggagagactatctcaggctttttgggcaagacggtctctgcgcatcctgtgacaagcgg
attcgtgcctatgagatgacaatgcgggtgaaagacaaagtgtatcacctggaatgtttc
aaatgcgccgcctgtcagaagcatttctgtgtaggtgacagatacctcctcatcaactct
gacatagtgtgcgaacaggacatctacgagtggactaagatcaatgggatgatatag

DBGET integrated database retrieval system