KEGG   Homo sapiens (human): 4005Help
Entry
4005              CDS       T01001                                 

Gene name
LMO2, LMO-2, RBTN2, RBTNL1, RHOM2, TTG2
Definition
(RefSeq) LIM domain only 2
  KO
K15612  rhombotin-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
N00121  LMO2-rearrangement to transcriptional activation
N00122  LMO2-rearrangement to transcriptional repression
Disease
H00002  T-cell acute lymphoblastic leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    4005 (LMO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM C1_4 TDH
Motif
Other DBs
NCBI-GeneID: 4005
NCBI-ProteinID: NP_001135787
OMIM: 180385
HGNC: 6642
Ensembl: ENSG00000135363
Vega: OTTHUMG00000157176
Pharos: P25791(Tbio)
UniProt: P25791
LinkDB All DBs
Structure
PDB: 

Position
11p13
AA seq 158 aa AA seqDB search
MSSAIERKSLDPSEEPVDEVLQIPPSLLTCGGCQQNIGDRYFLKAIDQYWHEDCLSCDLC
GCRLGEVGRRLYYKLGRKLCRRDYLRLFGQDGLCASCDKRIRAYEMTMRVKDKVYHLECF
KCAACQKHFCVGDRYLLINSDIVCEQDIYEWTKINGMI
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcggccatcgaaaggaagagcctggacccttcagaggaaccagtggatgaggtg
ctgcagatccccccatccctgctgacatgcggcggctgccagcagaacattggggaccgc
tacttcctgaaggccatcgaccagtactggcacgaggactgcctgagctgcgacctctgt
ggctgccggctgggtgaggtggggcggcgcctctactacaaactgggccggaagctctgc
cggagagactatctcaggctttttgggcaagacggtctctgcgcatcctgtgacaagcgg
attcgtgcctatgagatgacaatgcgggtgaaagacaaagtgtatcacctggaatgtttc
aaatgcgccgcctgtcagaagcatttctgtgtaggtgacagatacctcctcatcaactct
gacatagtgtgcgaacaggacatctacgagtggactaagatcaatgggatgatatag

KEGG   Homo sapiens (human): 5090Help
Entry
5090              CDS       T01001                                 

Gene name
PBX3
Definition
(RefSeq) PBX homeobox 3
  KO
K15610  pre-B-cell leukemia transcription factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    5090 (PBX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    5090 (PBX3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, PBC
    5090 (PBX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PBC Homeodomain Homeobox_KN YdaS_antitoxin Sec15 LZ3wCH
Motif
Other DBs
NCBI-GeneID: 5090
NCBI-ProteinID: NP_006186
OMIM: 176312
HGNC: 8634
Ensembl: ENSG00000167081
Vega: OTTHUMG00000020684
Pharos: P40426(Tbio)
UniProt: P40426 Q96AL5
LinkDB All DBs
Position
9q33.3
AA seq 434 aa AA seqDB search
MDDQSRMLQTLAGVNLAGHSVQGGMALPPPPHGHEGADGDGRKQDIGDILHQIMTITDQS
LDEAQAKKHALNCHRMKPALFSVLCEIKEKTGLSIRGAQEEDPPDPQLMRLDNMLLAEGV
SGPEKGGGSAAAAAAAAASGGSSDNSIEHSDYRAKLTQIRQIYHTELEKYEQACNEFTTH
VMNLLREQSRTRPISPKEIERMVGIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRR
NFSKQATEILNEYFYSHLSNPYPSEEAKEELAKKCSITVSQVSNWFGNKRIRYKKNIGKF
QEEANLYAAKTAVTAAHAVAAAVQNNQTNSPTTPNSGSSGSFNLPNSGDMFMNMQSLNGD
SYQGSQVGANVQSQVDTLRHVINQTGGYSDGLGGNSLYSPHNLNANGGWQDATTPSSVTS
PTEGPGSVHSDTSN
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atggacgatcaatccaggatgctgcagactctggccggggtgaacctggctggccactcg
gtgcaggggggcatggccctgccgcctcccccgcacggccacgaaggggcggacggcgac
ggcaggaagcaggacatcggcgacatcctccaccagatcatgaccatcaccgaccagagc
ttggacgaggcgcaagcaaagaaacatgccctgaactgtcacagaatgaaaccagcgctc
ttcagcgtcctgtgtgagatcaaagagaaaacaggtctcagcatcagaggagcccaggag
gaggaccctcccgatccccagctaatgagactggacaatatgcttttggcagaaggggtt
tcaggtcctgagaaaggtgggggatcggcggcagcagctgcagccgcggcagcctctgga
ggttcttcagataactctattgaacactcagattacagagccaaattgacccagatcaga
caaatctatcacacagaactggagaaatatgaacaggcatgtaatgaatttactacacat
gtgatgaaccttctccgagaacagagtagaacacgtcccatttctccaaaagagattgaa
agaatggtgggcatcatccatcgaaaatttagttccattcagatgcagctcaaacaaagc
acttgtgaagcagttatgattttaagatcaaggttccttgatgccagacggaaaaggcgt
aacttcagtaaacaggccacagaaatcttgaatgaatatttttactcacacctcagcaac
ccctaccccagtgaagaagccaaagaggagctggccaagaaatgcagcatcacagtgtca
caggtatccaattggtttggcaacaaacgaatcaggtacaagaagaacattggcaagttt
caggaagaagccaacctctatgctgcaaagacggccgtgacagctgcacacgcagtagca
gcagctgtgcagaacaaccagaccaattcgcccaccacaccaaattccggttcttctggt
tcttttaacctcccaaattctggggacatgttcatgaacatgcagagtctgaatggggat
tcttaccaagggtcccaagtcggagccaatgtgcaatcacaggtggataccctccgtcat
gttatcaatcagacgggaggctacagtgatggccttggaggaaattcactgtacagtcca
cataatttaaatgctaatggaggctggcaggacgcaacaactccatcttctgtgacttct
cctacagaaggcccaggaagtgtgcactcggatacctctaactaa

KEGG   Homo sapiens (human): 860Help
Entry
860               CDS       T01001                                 

Gene name
RUNX2, AML3, CBF-alpha-1, CBFA1, CCD, CCD1, CLCD, OSF-2, OSF2, PEA2aA, PEBP2aA
Definition
(RefSeq) RUNX family transcription factor 2
  KO
K09278  runt-related transcription factor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Disease
H00521  Cleidocranial dysplasia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    860 (RUNX2)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    860 (RUNX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    860 (RUNX2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   Runt
    860 (RUNX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Runt RunxI DUF2722 Spt20 DUF2828 EPL1 CCSAP Trp_oprn_chp Med3 TERB2 BAF1_ABF1
Motif
Other DBs
NCBI-GeneID: 860
NCBI-ProteinID: NP_001019801
OMIM: 600211
HGNC: 10472
Ensembl: ENSG00000124813
Vega: OTTHUMG00000014774
Pharos: Q13950(Tbio)
UniProt: Q13950
LinkDB All DBs
Position
6p21.1
AA seq 521 aa AA seqDB search
MASNSLFSTVTPCQQNFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQQQQQQQQQQQ
QQQQQQQQQQQEAAAAAAAAAAAAAAAAAVPRLRPPHDNRTMVEIIADHPAELVRTDSPN
FLCSVLPSHWRCNKTLPVAFKVVALGEVPDGTVVTVMAGNDENYSAELRNASAVMKNQVA
RFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPS
LFSDRLSDLGRIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYD
QSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFCLWPSTLSKKS
QAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTYTPPVTSGMSLGMSATTHYHT
YLPPPYPGSSQSQSGPFQTSSTPYLYYGTSSGSYQFPMVPGGDRSPSRMLPPCTTTSNGS
TLLNPNLPNQNDGVDADGSHSSSPTVLNSSGRMDESVWRPY
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaaacagcctcttcagcacagtgacaccatgtcagcaaaacttcttttgggat
ccgagcaccagccggcgcttcagccccccctccagcagcctgcagcccggcaaaatgagc
gacgtgagcccggtggtggctgcgcaacagcagcagcaacagcagcagcagcaacagcag
cagcagcagcagcaacagcagcagcagcagcaggaggcggcggcggcggctgcggcggcg
gcggcggctgcggcggcggcagctgcagtgccccggttgcggccgccccacgacaaccgc
accatggtggagatcatcgccgaccacccggccgaactcgtccgcaccgacagccccaac
ttcctgtgctcggtgctgccctcgcactggcgctgcaacaagaccctgcccgtggccttc
aaggtggtagccctcggagaggtaccagatgggactgtggttactgtcatggcgggtaac
gatgaaaattattctgctgagctccggaatgcctctgctgttatgaaaaaccaagtagca
aggttcaacgatctgagatttgtgggccggagtggacgaggcaagagtttcaccttgacc
ataaccgtcttcacaaatcctccccaagtagctacctatcacagagcaattaaagttaca
gtagatggacctcgggaacccagaaggcacagacagaagcttgatgactctaaacctagt
ttgttctctgaccgcctcagtgatttagggcgcattcctcatcccagtatgagagtaggt
gtcccgcctcagaacccacggccctccctgaactctgcaccaagtccttttaatccacaa
ggacagagtcagattacagaccccaggcaggcacagtcttccccgccgtggtcctatgac
cagtcttacccctcctacctgagccagatgacgtccccgtccatccactctaccaccccg
ctgtcttccacacggggcactgggcttcctgccatcaccgatgtgcctaggcgcatttca
gatgatgacactgccacctctgacttctgcctctggccttccactctcagtaagaagagc
caggcaggtgcttcagaactgggccctttttcagaccccaggcagttcccaagcatttca
tccctcactgagagccgcttctccaacccacgaatgcactatccagccacctttacttac
accccgccagtcacctcaggcatgtccctcggtatgtccgccaccactcactaccacacc
tacctgccaccaccctaccccggctcttcccaaagccagagtggacccttccagaccagc
agcactccatatctctactatggcacttcgtcaggatcctatcagtttcccatggtgccg
gggggagaccggtctccttccagaatgcttccgccatgcaccaccacctcgaatggcagc
acgctattaaatccaaatttgcctaaccagaatgatggtgttgacgctgatggaagccac
agcagttccccaactgttttgaattctagtggcagaatggatgaatctgtttggcgacca
tattga

KEGG   Homo sapiens (human): 4086Help
Entry
4086              CDS       T01001                                 

Gene name
SMAD1, BSP-1, BSP1, JV4-1, JV41, MADH1, MADR1
Definition
(RefSeq) SMAD family member 1
  KO
K04676  mothers against decapentaplegic homolog 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    4086 (SMAD1)
   04390 Hippo signaling pathway
    4086 (SMAD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    4086 (SMAD1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    4086 (SMAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MH2 MH1 IRF-3 DUF4223
Motif
Other DBs
NCBI-GeneID: 4086
NCBI-ProteinID: NP_001003688
OMIM: 601595
HGNC: 6767
Ensembl: ENSG00000170365
Vega: OTTHUMG00000161592
Pharos: Q15797(Tbio)
UniProt: Q15797
LinkDB All DBs
Structure
PDB: 

Position
4q31.21
AA seq 465 aa AA seqDB search
MNVTSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSCPGQ
PSNCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSKQKEV
CINPYHYKRVESPVLPPVLVPRHSEYNPQHSLLAQFRNLGQNEPHMPLNATFPDSFQQPN
SHPFPHSPNSSYPNSPGSSSSTYPHSPTSSDPGSPFQMPADTPPPAYLPPEDPMTQDGSQ
PMDTNMMAPPLPSEINRGDVQAVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFT
DPSNNKNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNC
NYHHGFHPTTVCKIPSGCSLKIFNNQEFAQLLAQSVNHGFETVYELTKMCTIRMSFVKGW
GAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtgacaagtttattttcctttacaagtccagctgtgaagagacttcttgggtgg
aaacagggcgatgaagaagaaaaatgggcagagaaagctgttgatgctttggtgaaaaaa
ctgaagaaaaagaaaggtgccatggaggaactggaaaaggccttgagctgcccagggcaa
ccgagtaactgtgtcaccattccccgctctctggatggcaggctgcaagtctcccaccgg
aagggactgcctcatgtcatttactgccgtgtgtggcgctggcccgatcttcagagccac
catgaactaaaaccactggaatgctgtgagtttccttttggttccaagcagaaggaggtc
tgcatcaatccctaccactataagagagtagaaagccctgtacttcctcctgtgctggtt
ccaagacacagcgaatataatcctcagcacagcctcttagctcagttccgtaacttagga
caaaatgagcctcacatgccactcaacgccacttttccagattctttccagcaacccaac
agccacccgtttcctcactctcccaatagcagttacccaaactctcctgggagcagcagc
agcacctaccctcactctcccaccagctcagacccaggaagccctttccagatgccagct
gatacgcccccacctgcttacctgcctcctgaagaccccatgacccaggatggctctcag
ccgatggacacaaacatgatggcgcctcccctgccctcagaaatcaacagaggagatgtt
caggcggttgcttatgaggaaccaaaacactggtgctctattgtctactatgagctcaac
aatcgtgtgggtgaagcgttccatgcctcctccacaagtgtgttggtggatggtttcact
gatccttccaacaataagaaccgtttctgccttgggctgctctccaatgttaaccggaat
tccactattgaaaacaccaggcggcatattggaaaaggagttcatctttattatgttgga
ggggaggtgtatgccgaatgccttagtgacagtagcatctttgtgcaaagtcggaactgc
aactaccatcatggatttcatcctactactgtttgcaagatccctagtgggtgtagtctg
aaaatttttaacaaccaagaatttgctcagttattggcacagtctgtgaaccatggattt
gagacagtctatgagcttacaaaaatgtgtactatacgtatgagctttgtgaagggctgg
ggagcagaataccaccgccaggatgttactagcaccccctgctggattgagatacatctg
cacggccccctccagtggctggataaagttcttactcaaatgggttcacctcataatcct
atttcatctgtatcttaa

KEGG   Homo sapiens (human): 51274Help
Entry
51274             CDS       T01001                                 

Gene name
KLF3, BKLF
Definition
(RefSeq) Kruppel like factor 3
  KO
K15605  krueppel-like factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    51274 (KLF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    51274 (KLF3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    51274 (KLF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-C2H2_6 DUF1071
Motif
Other DBs
NCBI-GeneID: 51274
NCBI-ProteinID: NP_057615
OMIM: 609392
HGNC: 16516
Ensembl: ENSG00000109787
Vega: OTTHUMG00000097821
Pharos: P57682(Tbio)
UniProt: P57682 A0A024R9T8
LinkDB All DBs
Position
4p14
AA seq 345 aa AA seqDB search
MLMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLPEKFFQTPEGLSHGIQME
PVDLTVNKRSSPPSAGNSPSSLKFPSSHRRASPGLSMPSSSPPIKKYSPPSPGVQPFGVP
LSMPPVMAAALSRHGIRSPGILPVIQPVVVQPVPFMYTSHLQQPLMVSLSEEMENSSSSM
QVPVIESYEKPISQKKIKIEPGIEPQRTDYYPEEMSPPLMNSVSPPQALLQENHPSVIVQ
PGKRPLPVESPDTQRKRRIHRCDYDGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWK
FARSDELTRHFRKHTGIKPFQCPDCDRSFSRSDHLALHRKRHMLV
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgctcatgtttgacccagttcctgtcaagcaagaggccatggaccctgtctcagtgtca
tacccatctaattacatggaatccatgaagcctaacaagtatggggtcatctactccaca
ccattgcctgagaagttctttcagaccccagaaggtctgtcgcacggaatacagatggag
ccagtggacctcacggtgaacaagcggagttcacccccttcggctgggaattcgccctcc
tctctgaagttcccgtcctcacaccggagagcctcgcctgggttgagcatgccttcttcc
agcccaccgataaaaaaatactcacccccttctccaggcgtgcagcccttcggcgtgccg
ctgtccatgccaccagtgatggcagctgccctctcgcggcatggaatacggagcccgggg
atcctgcccgtcatccagccggtggtggtgcagcccgtcccctttatgtacacaagtcac
ctccagcagcctctcatggtctccttatcggaggagatggaaaattccagtagtagcatg
caagtacctgtaattgaatcatatgagaagcctatatcacagaaaaaaattaaaatagaa
cctgggatcgaaccacagaggacagattattatcctgaagaaatgtcaccccccttaatg
aactcagtgtcccccccgcaagcattgttgcaagagaatcacccttcggtcatcgtgcag
cctgggaagagacctttacctgtggaatccccggatactcaaaggaagcggaggatacac
agatgtgattatgatggatgcaacaaagtgtacactaaaagctcccacttgaaagcacac
agaagaacacacacaggagaaaaaccctacaaatgtacatgggaagggtgcacatggaag
tttgctcggtctgatgaactaacaagacatttccgaaaacatactggaatcaaacctttc
cagtgcccggactgtgaccgcagcttctcccgttctgaccatcttgccctccataggaaa
cgccacatgctagtctga

KEGG   Homo sapiens (human): 4208Help
Entry
4208              CDS       T01001                                 

Gene name
MEF2C, C5DELq14.3, DEL5q14.3
Definition
(RefSeq) myocyte enhancer factor 2C
  KO
K04454  MADS-box transcription enhancer factor 2C
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04371  Apelin signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa05202  Transcriptional misregulation in cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Disease
H00773  Autosomal dominant mental retardation
H01223  Mental retardation-stereotypic movements-epilepsy and/or cerebral malformations
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4208 (MEF2C)
   04371 Apelin signaling pathway
    4208 (MEF2C)
   04022 cGMP-PKG signaling pathway
    4208 (MEF2C)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    4208 (MEF2C)
   04928 Parathyroid hormone synthesis, secretion and action
    4208 (MEF2C)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    4208 (MEF2C)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    4208 (MEF2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4208 (MEF2C)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   MADS-box regulators of differentiation, MEF-2
    4208 (MEF2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRF-TF HJURP_C GHD
Motif
Other DBs
NCBI-GeneID: 4208
NCBI-ProteinID: NP_001180279
OMIM: 600662
HGNC: 6996
Ensembl: ENSG00000081189
Vega: OTTHUMG00000162634
Pharos: Q06413(Tbio)
UniProt: Q06413 A0A024RAL7
LinkDB All DBs
Position
5q14.3
AA seq 473 aa AA seqDB search
MGRKKIQITRIMDERNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSTNKLFQYAST
DMDKVLLKYTEYNEPHESRTNSDIVETLRKKGLNGCDSPDPDADDSVGHSPESEDKYRKI
NEDIDLMISRQRLCAVPPPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRN
SMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKS
PPPMNLGMNNRKPDLRVLIPPGSKNTMPSVSEDVDLLLNQRINNSQSAQSLATPVVSVAT
PTLPGQGMGGYPSAISTTYGTEYSLSSADLSSLSGFNTASALHLGSVTGWQQQHLHNMPP
SALSQLGACTSTHLSQSSNLSLPSTQSLNIKSEPVSPPRDRTTTPSRYPQHTRHEAGRSP
VDSLSSCSSSYDGSDREDHRNEFHSPIGLTRPSPDERESPSVKRMRLSEGWAT
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atggggagaaaaaagattcagattacgaggattatggatgaacgtaacagacaggtgaca
tttacaaagaggaaatttgggttgatgaagaaggcttatgagctgagcgtgctgtgtgac
tgtgagattgcgctgatcatcttcaacagcaccaacaagctgttccagtatgccagcacc
gacatggacaaagtgcttctcaagtacacggagtacaacgagccgcatgagagccggaca
aactcagacatcgtggagacgttgagaaagaagggccttaatggctgtgacagcccagac
cccgatgcggacgattccgtaggtcacagccctgagtctgaggacaagtacaggaaaatt
aacgaagatattgatctaatgatcagcaggcaaagattgtgtgctgttccacctcccaac
ttcgagatgccagtctccatcccagtgtccagccacaacagtttggtgtacagcaaccct
gtcagctcactgggaaaccccaacctattgccactggctcacccttctctgcagaggaat
agtatgtctcctggtgtaacacatcgacctccaagtgcaggtaacacaggtggtctgatg
ggtggagacctcacgtctggtgcaggcaccagtgcagggaacgggtatggcaatccccga
aactcaccaggtctgctggtctcacctggtaacttgaacaagaatatgcaagcaaaatct
cctcccccaatgaatttaggaatgaataaccgtaaaccagatctccgagttcttattcca
ccaggcagcaagaatacgatgccatcagtgtctgaggatgtcgacctgcttttgaatcaa
aggataaataactcccagtcggctcagtcattggctaccccagtggtttccgtagcaact
cctactttaccaggacaaggaatgggaggatatccatcagccatttcaacaacatatggt
accgagtactctctgagtagtgcagacctgtcatctctgtctgggtttaacaccgccagc
gctcttcaccttggttcagtaactggctggcaacagcaacacctacataacatgccacca
tctgccctcagtcagttgggagcttgcactagcactcatttatctcagagttcaaatctc
tccctgccttctactcaaagcctcaacatcaagtcagaacctgtttctcctcctagagac
cgtaccaccaccccttcgagatacccacaacacacgcgccacgaggcggggagatctcct
gttgacagcttgagcagctgtagcagttcgtacgacgggagcgaccgagaggatcaccgg
aacgaattccactcccccattggactcaccagaccttcgccggacgaaagggaaagtccc
tcagtcaagcgcatgcgactttctgaaggatgggcaacatga

KEGG   Homo sapiens (human): 3205Help
Entry
3205              CDS       T01001                                 

Gene name
HOXA9, ABD-B, HOX1, HOX1.7, HOX1G
Definition
(RefSeq) homeobox A9
  KO
K21950  homeobox protein Hox-A9
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
N00120  MLL-ENL fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3205 (HOXA9)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3205 (HOXA9)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, AbdB
    3205 (HOXA9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hox9_act Homeodomain HTH_23
Motif
Other DBs
NCBI-GeneID: 3205
NCBI-ProteinID: NP_689952
OMIM: 142956
HGNC: 5109
Ensembl: ENSG00000078399
Vega: OTTHUMG00000023220
Pharos: P31269(Tbio)
UniProt: P31269
LinkDB All DBs
Position
7p15.2
AA seq 272 aa AA seqDB search
MATTGALGNYYVDSFLLGADAADELSVGRYAPGTLGQPPRQAATLAEHPDFSPCSFQSKA
TVFGASWNPVHAAGANAVPAAVYHHHHHHPYVHPQAPVAAAAPDGRYMRSWLEPTPGALS
FAGLPSSRPYGIKPEPLSARRGDCPTLDTHTLSLTDYACGSPPVDREKQPSEGAFSENNA
ENESGGDKPPIDPNNPAANWLHARSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVA
RLLNLTERQVKIWFQNRRMKMKKINKDRAKDE
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atggccaccactggggccctgggcaactactacgtggactcgttcctgctgggcgccgac
gccgcggatgagctgagcgttggccgctatgcgccggggaccctgggccagcctccccgg
caggcggcgacgctggccgagcaccccgacttcagcccgtgcagcttccagtccaaggcg
acggtgtttggcgcctcgtggaacccagtgcacgcggcgggcgccaacgctgtacccgct
gcggtgtaccaccaccatcaccaccacccctacgtgcacccccaggcgcccgtggcggcg
gcggcgccggacggcaggtacatgcgctcctggctggagcccacgcccggtgcgctctcc
ttcgcgggcttgccctccagccggccttatggcattaaacctgaaccgctgtcggccaga
aggggtgactgtcccacgcttgacactcacactttgtccctgactgactatgcttgtggt
tctcctccagttgatagagaaaaacaacccagcgaaggcgccttctctgaaaacaatgct
gagaatgagagcggcggagacaagccccccatcgatcccaataacccagcagccaactgg
cttcatgcgcgctccactcggaaaaagcggtgcccctatacaaaacaccagaccctggaa
ctggagaaagagtttctgttcaacatgtacctcaccagggaccgcaggtacgaggtggct
cgactgctcaacctcaccgagaggcaggtcaagatctggttccagaaccgcaggatgaaa
atgaagaaaatcaacaaagaccgagcaaaagacgagtga

KEGG   Homo sapiens (human): 3206Help
Entry
3206              CDS       T01001                                 

Gene name
HOXA10, HOX1, HOX1.8, HOX1H, PL
Definition
(RefSeq) homeobox A10
  KO
K17443  homrobox protein Hox-A10
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
N00120  MLL-ENL fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    3206 (HOXA10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    3206 (HOXA10)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, AbdB
    3206 (HOXA10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 3206
NCBI-ProteinID: NP_061824
OMIM: 142957
HGNC: 5100
Ensembl: ENSG00000253293
Vega: OTTHUMG00000023436
Pharos: P31260(Tbio)
UniProt: P31260
LinkDB All DBs
Position
7p15.2
AA seq 410 aa AA seqDB search
MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAH
GGVYLPPAADLPYGLQSCGLFPTLGGKRNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLD
APRSCRMEPPDGPPPPPQQQPPPPPQPPQPAPQATSCSFAQNIKEESSYCLYDSADKCPK
VSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTAKGYGSGGGGAQQLGAGP
FPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAE
ELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMY
LTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgtcagccagaaagggctatctgctcccttcgccaaattatcccacaacaatgtcatgc
tcggagagccccgccgcgaactcttttttggtcgactcgctcatcagctcgggcagaggc
gaggcaggcggcggtggtggtggcgcggggggcggcggcggtggcggttactacgcccac
ggcggggtctacctgccgcccgccgccgacctgccctacgggctgcagagctgcgggctc
ttccccacgctgggcggcaagcgcaatgaggcagcgtcgccgggcagcggtggcggtggc
gggggtctaggtcccggggcgcacggctacgggccctcgcccatagacctgtggctagac
gcgccccggtcttgccggatggagccgcctgacgggccgccgccgccgccccagcagcag
ccgccgcccccgccgcaaccaccccagccagcgccgcaggccacctcgtgctctttcgcg
cagaacatcaaagaagagagctcctactgcctctacgactcggcggacaaatgccccaaa
gtctcggccaccgccgccgaactggctcccttcccgcggggcccgccgcccgacggctgc
gccctgggcacctccagcggggtgccagtgcctggctacttccgcctttctcaggcctac
ggcaccgccaagggctatggcagcggcggcggcggcgcgcagcaactcggggctggcccg
ttccccgcgcagcccccggggcgcggtttcgatctcccgcccgcgctagcctccggctcg
gccgatgcggcccggaaggagcgagccctcgattcgccgccgccccccacgctggcttgc
ggcagcggcgggggctcgcagggcgacgaggaggcgcacgcgtcgtcctcggccgcggag
gagctctccccggccccttccgagagcagcaaagcctcgccggagaaggattccctgggc
aattccaaaggtgaaaacgcagccaactggctcacggcaaagagtggtcggaagaagcgc
tgcccctacacgaagcaccagacactggagctggagaaggagtttctgttcaatatgtac
cttactcgagagcggcgcctagagattagccgcagcgtccacctcacggacagacaagtg
aaaatctggtttcagaaccgcaggatgaaactgaagaaaatgaatcgagaaaaccggatc
cgggagctcacagccaactttaatttttcctga

KEGG   Homo sapiens (human): 221037Help
Entry
221037            CDS       T01001                                 

Gene name
JMJD1C, KDM3C, TRIP-8, TRIP8
Definition
(RefSeq) jumonji domain containing 1C
  KO
K11449  jumonji domain-containing protein 1C [EC:1.14.11.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    221037 (JMJD1C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    221037 (JMJD1C)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     221037 (JMJD1C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    221037 (JMJD1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JmjC zf-C5HC2 C1_2
Motif
Other DBs
NCBI-GeneID: 221037
NCBI-ProteinID: NP_116165
OMIM: 604503
HGNC: 12313
Ensembl: ENSG00000171988
Vega: OTTHUMG00000018311
Pharos: Q15652(Tbio)
UniProt: Q15652
LinkDB All DBs
Structure
PDB: 

Position
10q21.3
AA seq 2540 aa AA seqDB search
MAVETRAELVGKRFLCVAVGDEARSERWESGRGWRSWRAGVIRAVSHRDSRNPDLAVYVE
FDDLEWDKREWVKVYEDFSTFLVEYHLIWAKRNDPSQTQGSKSKQIQWPALTFKPLVERN
IPSSVTAVEFLVDKQLDFLTEDSAFQPYQDDIDSLNPVLRDNPQLHEEVKVWVKEQKVQE
IFMQGPYSLNGYRVRVYRQDSATQWFTGIITHHDLFTRTMIVMNDQVLEPQNVDPSMVQM
TFLDDVVHSLLKGENIGITSRRRSRANQNVNAVHSHYTRAQANSPRPAMNSQAAVPKQNT
HQQQQQRSIRPNKRKGSDSSIPDEEKMKEEKYDYISRGENPKGKNKHLMNKRRKPEEDEK
KLNMKRLRTDNVSDFSESSDSENSNKRIIDNSSEQKPENELKNKNTSKINGEEGKPHNNE
KAGEETLKNSQPPWDQIQEDKKHEEAEKRKSVDTQLQEDMIIHSSEQSTVSDHNSNDLLP
QECNMDKTHTMELLPKEKFVSRPPTPKCVIDITNDTNLEKVAQENSSTFGLQTLQKMDPN
VSDSKHSIANAKFLETAKKDSDQSWVSDVVKVDLTQSSVTNASSGNDHLNMEKEKYVSYI
SPLSAVSVMEDKLHKRSPPPETIKSKLNTSVDTHKIKSSPSPEVVKPKITHSPDSVKSKA
TYVNSQATGERRLANKIEHELSRCSFHPIPTRSSTLETTKSPLIIDKNEHFTVYRDPALI
GSETGANHISPFLSQHPFPLHSSSHRTCLNPGTHHPALTPAPHLLAGSSSQTPLPTINTH
PLTSGPHHAVHHPHLLPTVLPGVPTASLLGGHPRLESAHASSLSHLALAHQQQQQLLQHQ
SPHLLGQAHPSASYNQLGLYPIIWQYPNGTHAYSGLGLPSSKWVHPENAVNAEASLRRNS
PSPWLHQPTPVTSADGIGLLSHIPVRPSSAEPHRPLKITAHSSPPLTKTLVDHHKEELER
KAFMEPLRSVASTSAKNDLDLNRSQTGKDCHLHRHFVDPVLNQLQRPPQETGERLNKYKE
EHRRILQESIDVAPFTTKIKGLEGERENYSRVASSSSSPKSHIIKQDMDVERSVSDLYKM
KHSVPQSLPQSNYFTTLSNSVVNEPPRSYPSKEVSNIYGDKQSNALAAAAANPQTLTSFI
TSLSKPPPLIKHQPESEGLVGKIPEHLPHQIASHSVTTFRNDCRSPTHLTVSSTNTLRSM
PALHRAPVFHPPIHHSLERKEGSYSSLSPPTLTPVMPVNAGGKVQESQKPPTLIPEPKDS
QANFKSSSEQSLTEMWRPNNNLSKEKTEWHVEKSSGKLQAAMASVIVRPSSSTKTDSMPA
MQLASKDRVSERSSAGAHKTDCLKLAEAGETGRIILPNVNSDSVHTKSEKNFQAVSQGSV
PSSVMSAVNTMCNTKTDVITSAADTTSVSSWGGSEVISSLSNTILASTSSECVSSKSVSQ
PVAQKQECKVSTTAPVTLASSKTGSVVQPSSGFSGTTDFIHLKKHKAALAAAQYKSSNAS
ETEPNAIKNQTLSASLPLDSTVICSTINKANSVGNGQASQTSQPNYHTKLKKAWLTRHSE
EDKNTNKMENSGNSVSEIIKPCSVNLIASTSSDIQNSVDSKIIVDKYVKDDKVNRRKAKR
TYESGSESGDSDESESKSEQRTKRQPKPTYKKKQNDLQKRKGEIEEDLKPNGVLSRSAKE
RSKLKLQSNSNTGIPRSVLKDWRKVKKLKQTGESFLQDDSCCEIGPNLQKCRECRLIRSK
KGEEPAHSPVFCRFYYFRRLSFSKNGVVRIDGFSSPDQYDDEAMSLWTHENFEDDELDIE
TSKYILDIIGDKFCQLVTSEKTALSWVKKDAKIAWKRAVRGVREMCDACEATLFNIHWVC
QKCGFVVCLDCYKAKERKSSRDKELYAWMKCVKGQPHDHKHLMPTQIIPGSVLTDLLDAM
HTLREKYGIKSHCHCTNKQNLQVGNFPTMNGVSQVLQNVLNHSNKISLCMPESQQQNTPP
KSEKNGGSSPESDVGTDNKLTPPESQSPLHWLADLAEQKAREEKKENKELTLENQIKEER
EQDNSESPNGRTSPLVSQNNEQGSTLRDLLTTTAGKLRVGSTDAGIAFAPVYSMGAPSSK
SGRTMPNILDDIIASVVENKIPPSKTSKINVKPELKEEPEESIISAVDENNKLYSDIPHS
WICEKHILWLKDYKNSSNWKLFKECWKQGQPAVVSGVHKKMNISLWKAESISLDFGDHQA
DLLNCKDSIISNANVKEFWDGFEEVSKRQKNKSGETVVLKLKDWPSGEDFKTMMPARYED
LLKSLPLPEYCNPEGKFNLASHLPGFFVRPDLGPRLCSAYGVVAAKDHDIGTTNLHIEVS
DVVNILVYVGIAKGNGILSKAGILKKFEEEDLDDILRKRLKDSSEIPGALWHIYAGKDVD
KIREFLQKISKEQGLEVLPEHDPIRDQSWYVNKKLRQRLLEEYGVRTCTLIQFLGDAIVL
PAGALHQVQNFHSCIQVTEDFVSPEHLVESFHLTQELRLLKEEINYDDKLQVKNILYHAV
KEMVRALKIHEDEVEDMEEN
NT seq 7623 nt NT seq  +upstreamnt  +downstreamnt
atggcggtagagacgcgggcagagctggtgggtaagcggttcctgtgtgtggcggtcggc
gacgaggcacgttcggagcgctgggagagcggacgcggctggcgaagctggcgagcgggg
gtcatccgagccgtgtcacacagggacagccgcaatccggacctggcggtgtatgtggaa
tttgatgatcttgaatgggataaacgagagtgggttaaagtttatgaagatttttcaact
ttcttggtggaataccacttaatctgggccaaaaggaatgaccctagccagactcaggga
tcaaagagcaaacagattcagtggcctgcattgactttcaaacctctggttgaaagaaat
atacccagttcagtcactgcagtagaattccttgtagataagcaactggattttttaact
gaagatagtgcctttcagccctaccaggacgacatagacagcctaaacccagttctcagg
gacaacccgcagcttcatgaggaagtgaaagtctgggtaaaggaacaaaaggttcaggag
atttttatgcaaggtccttattccttaaatggatacagagtgagagtatatagacaagac
tctgccacccagtggtttactggcataattactcatcatgatctcttcacccgcaccatg
atcgttatgaatgatcaggtactagaaccacagaatgtcgatccttctatggttcaaatg
acctttctagatgatgttgttcactctttgttaaaaggtgaaaatattggcattacatca
cgacgcaggtctcgtgccaatcaaaacgtcaacgctgttcacagccattatacacgtgcc
caagcaaatagtcccagaccagcaatgaactcccaagctgctgtaccaaaacagaataca
caccagcaacagcaacaaagaagtatccgtccaaataagaggaagggctcagatagcagt
ataccagatgaagagaagatgaaggaggaaaaatatgattatatatcacgaggagaaaat
cctaaaggtaaaaacaaacacttgatgaataaaagaaggaaacctgaggaggatgaaaag
aaactaaatatgaaaagacttcgaactgacaatgtttcagacttttctgagagcagtgac
tcagaaaattcaaataagagaataatagataattcctcagaacagaagccagagaatgaa
ttgaaaaataaaaatacttcaaaaataaatggagaagaaggaaaaccccataataatgag
aaggcaggagaagagaccctaaaaaatagccagcctccctgggatcaaatacaggaagat
aaaaaacatgaagaagcagagaagcggaagtctgttgacactcagcttcaagaagatatg
attattcattcgtcagaacagtccacagtttctgatcataattctaatgatttacttcct
caggaatgcaatatggataaaacacataccatggaattgctaccaaaggagaagtttgta
tccagaccacccacaccaaaatgtgttattgatattacaaatgacactaatttagaaaag
gtggctcaggaaaactcaagtacctttggccttcagacacttcagaaaatggatcctaat
gttagtgattcaaaacactctattgcaaatgcaaaattcttggaaacagcaaaaaaagat
tctgaccagagctgggtcagtgatgtagttaaagtggatctaacccaatcaagtgttaca
aatgcttcttcaggaaatgatcacttgaacatggaaaaagagaagtatgtctcttacatt
tctcctttaagtgcagtttctgtcatggaagataagctgcataagcgaagtccacctcca
gagactataaaatctaaacttaatacttcagtagatactcacaagataaaatccagccca
tcacctgaagttgttaaacccaaaataactcattctcctgattctgtaaagtctaaggcc
acttatgtgaacagccaagctactggtgaaagaagattggcaaataagatagaacatgag
ctatcaagatgcagttttcatccaattcctactcgaagcagtacattagaaactacaaag
agtcctcttatcattgataaaaatgagcattttacagtttacagagatcctgcacttatt
gggtcagaaacaggagctaatcatatttcacctttcctaagccagcatccttttcctctt
cactcctcatctcatagaacctgtttaaatccaggtacccatcatcctgccttaactcct
gcaccccatttactagccggatcatctagtcaaactccattacctaccattaacactcat
cctctgactagtggtccacaccatgctgttcatcaccctcatttacttcccactgtgtta
cctggagtgcctactgcctccttacttggtggccacccacgactagagagtgctcatgcc
agcagcttgagccacttagcgctagcacaccagcaacaacaacagttgttacagcaccag
tcacctcatcttcttggacaagcccatccttctgcttcatataatcagcttggactttat
ccaattatttggcagtatccaaatggaacacatgcatactcaggacttggtttgccttct
tctaagtgggttcacccagaaaatgcagttaatgctgaagcttcattaaggaggaattct
cccagtccttggctacatcagcccacccctgtgacctcagcagatggtattggattactt
agtcacattcctgtcagaccttccagtgcagagcctcatcggcctcttaaaattacagcc
cattccagtccaccattgacaaaaactttagtagatcatcataaggaagaattagaaaga
aaagcttttatggaaccattacggtctgttgcatccacatcagccaaaaatgacctggat
ctaaataggtcacagactggaaaagattgtcacttacataggcattttgtggatccagta
ttaaatcagttacagaggccaccccaggagactggagagaggttaaacaaatacaaagag
gaacaccgtcgaattcttcaagaaagtattgatgttgctccctttacaactaaaatcaag
ggacttgagggtgagagagagaattattccagagtggcatcatcatcttccagtcctaaa
agccatatcatcaaacaagatatggatgtagaacgctcagtatcagatctttataaaatg
aagcactcagtgcctcagagtttaccccaaagtaactatttcactacattgtctaatagt
gtggtcaatgaaccaccaagatcatacccatccaaagaagtttcaaatatttacggtgat
aaacagagtaatgcccttgcagcggcagcagctaatcctcaaactctgacttcatttata
acatctctttcaaagcctccacctttgattaaacaccaaccagaaagtgaaggtttagta
ggcaagataccagaacatcttccacatcagattgcatctcactcagtaacaaccttcaga
aatgattgtaggagtcctacccatttgacagtttcttctacaaatacactccgcagtatg
cctgcattacatagagcaccagtatttcacccaccaatccatcacagcctggaaagaaag
gaaggcagctatagtagtctttcccctccaactttaactccggtgatgccagtaaatgct
ggtggtaaagttcaagaatcacagaagcctccaactctaatacccgaaccaaaagactcc
caggcaaattttaagagttcttcagaacagagtttgacggagatgtggagacctaataat
aacctcagcaaagagaaaactgaatggcatgtggagaaaagcagcggaaagttacaggct
gctatggcatctgtcattgtgcgtccatcttctagtacaaaaactgatagtatgccagca
atgcagttagcttctaaagatcgtgttagtgaaagatcttcagctggggcacataaaaca
gattgcctcaaactagcagaagccggagaaactggaagaatcattttgccaaatgtgaat
tcagacagtgttcacacaaaatctgaaaaaaactttcaggctgtctcacagggcagtgtt
cccagttcagtcatgtctgctgtaaatacgatgtgtaataccaaaacggatgtaatcaca
tctgctgccgatactaccagtgtttccagctggggtggttcagaagtaatttcctcttta
tcaaataccattttggcctctacatcatcagaatgtgtatcttcaaaaagtgtcagtcag
ccagtggctcaaaaacaagaatgcaaggtcagcaccacagcaccagttacattagccagt
agtaagacaggaagtgttgttcaacccagttctgggttctcaggcacaactgattttatc
catttaaaaaagcacaaggcagcattggctgcagctcagtataaaagtagtaatgccagt
gagactgaacctaatgctataaaaaatcagacactttcagcctcccttcctctggatagc
actgtaatctgtagtacaattaacaaagcaaactctgtaggaaatgggcaagcttcccag
acaagtcaaccaaactaccatactaaactgaaaaaggcctggctcaccagacactcagaa
gaagataaaaatactaataaaatggaaaattcagggaattctgtatcagaaattattaag
ccatgttctgtcaacttaatagcctctacatctagtgatatacaaaatagtgtagatagt
aagatcatagttgataaatatgtaaaagatgataaagtcaacaggagaaaagccaaaaga
acttatgaatctggctctgaaagtggagactcagatgaaagtgaaagcaagtcagagcaa
aggactaaaagacaacctaagccaacttacaaaaagaagcaaaatgatttgcaaaagaga
aaaggtgaaatagaagaagatttgaaacccaatggagttctcagcaggagtgccaaagaa
agaagtaaactgaagttgcaaagcaacagtaatactggcattcctcgttcagtattgaaa
gattggcgtaaagtcaagaagctgaagcaaactggggaatcctttttacaggatgactcc
tgctgtgagatagggcctaatttacaaaagtgtcgagaatgtagacttattcgcagtaaa
aaaggagaagaaccagctcactcaccagtattttgtagattttactactttagacggttg
tcatttagtaaaaacggagtagttagaatagatggtttctcttctcctgaccaatatgat
gatgaagctatgagtttgtggacacatgaaaattttgaagatgatgaactagatatagag
acttctaaatatatcttggatataataggtgataagttctgtcaattagtaacatctgaa
aaaacagctttgtcctgggtgaaaaaggatgccaaaattgcctggaaaagagcagtgaga
ggagtccgggagatgtgtgatgcatgtgaagcaacattgtttaacattcactgggtctgc
caaaaatgtggatttgtggtctgcttagattgttacaaggcaaaggaaaggaagagttct
agagataaagaactatatgcttggatgaagtgtgtgaagggacagcctcatgatcacaaa
catttaatgccaacccaaattatacctggttctgttttgacagatcttctagatgccatg
cacactcttagggaaaaatatggtattaaatcccattgtcattgtactaacaaacagaat
ttacaagttggaaattttcctacaatgaatggtgtatctcaagttttacagaatgttctt
aatcacagtaataaaatttctctgtgcatgcctgagtctcagcagcaaaatactcctccg
aagtctgagaaaaatggtggcagcagcccagagagtgatgtaggcacagataacaagtta
actcctccagaatcccagtcaccactgcactggttagcagatcttgcagagcaaaaagcc
agagaggaaaaaaaagaaaacaaagaacttacccttgaaaaccaaattaaagaagaaaga
gaacaagacaactctgaatctccaaatggcagaacatcacctcttgtgtcccagaataat
gaacaaggctcaaccttacgggatttgctgactacaacagctggaaagctacgtgtgggg
tctacagatgctggcattgcctttgccccagtatattcaatgggagccccaagtagcaaa
agtggacggactatgcctaacattcttgatgacataattgcttcagttgttgaaaacaaa
attccaccaagtaaaacctccaagataaatgtaaaaccagagcttaaagaagagcctgaa
gaaagcataatatctgcagtggatgaaaataataaattatacagtgatataccacattct
tggatctgtgagaagcatattttatggcttaaggattataagaatagcagtaattggaag
cttttcaaagaatgttggaaacaaggacagcctgcagtggtttctggtgtgcataagaaa
atgaacattagcctatggaaggcggaatcaattagtcttgattttggagaccaccaagct
gatctcctgaactgcaaagatagcatcatttcaaatgccaatgttaaggaattctgggat
ggttttgaagaagtttcaaaacggcagaaaaacaagagtggagaaacagttgttttaaaa
ttgaaagactggccttcaggagaagacttcaagactatgatgccagcaagatacgaagat
cttttaaaaagtctgccattgccagaatattgtaatccagaaggaaaattcaatttggcc
tctcatttgccaggattttttgtacgtcctgatctaggacccaggttgtgcagtgcctat
ggtgtagttgctgctaaagatcatgatataggaacaacaaatctccatattgaagtttct
gatgttgtaaatatactagtttatgttggcatagcaaaaggaaatggcattctctcaaaa
gcaggaattctcaagaaatttgaggaagaagatttggatgacattttaaggaaaagattg
aaggactcaagtgaaatacctggtgctctgtggcatatttatgctgggaaagatgttgac
aagataagggaatttcttcaaaagatttcaaaagaacaaggccttgaagttctaccagaa
catgatccaatacgtgaccaaagttggtatgtgaacaaaaagctccgtcaaaggctgctt
gaagaatatggagtcagaacctgtactcttattcagttccttggtgatgctattgttttg
ccagcgggagcacttcatcaggttcagaattttcacagctgtattcaggtaactgaagat
tttgtgtctccagaacatcttgtagagtcatttcatttaacacaggaactgagacttttg
aaggaagaaatcaattatgatgataaactacaggttaaaaatattttgtatcatgcagtc
aaagaaatggtgagagccttgaagatacacgaggatgaagtagaggatatggaagaaaat
taa

KEGG   Homo sapiens (human): 8091Help
Entry
8091              CDS       T01001                                 

Gene name
HMGA2, BABL, HMGI-C, HMGIC, LIPO, STQTL9
Definition
(RefSeq) high mobility group AT-hook 2
  KO
K09283  high mobility group AT-hook protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
hsa05206  MicroRNAs in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Disease
H01640  Uterine leiomyoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8091 (HMGA2)
   05206 MicroRNAs in cancer
    8091 (HMGA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    8091 (HMGA2)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8091 (HMGA2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Other transcription factors
   HMGI(Y)
    8091 (HMGA2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Nucleosome assembly factors
   HMG (high mobility group) proteins
    8091 (HMGA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AT_hook
Motif
Other DBs
NCBI-GeneID: 8091
NCBI-ProteinID: NP_003474
OMIM: 600698
HGNC: 5009
Ensembl: ENSG00000149948
Vega: OTTHUMG00000168936
Pharos: P52926(Tbio)
UniProt: P52926
LinkDB All DBs
Position
12q14.3
AA seq 109 aa AA seqDB search
MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSP
SKAAQKKAEATGEKRPRGRPRKWPQQVVQKKPAQEETEETSSQESAEED
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcacgcggtgagggcgcggggcagccgtccacttcagcccagggacaacctgcc
gccccagcgcctcagaagagaggacgcggccgccccaggaagcagcagcaagaaccaacc
ggtgagccctctcctaagagacccaggggaagacccaaaggcagcaaaaacaagagtccc
tctaaagcagctcaaaagaaagcagaagccactggagaaaaacggccaagaggcagacct
aggaaatggccacaacaagttgttcagaagaagcctgctcaggaggaaactgaagagaca
tcctcacaagagtctgccgaagaggactag

KEGG   Homo sapiens (human): 7403Help
Entry
7403              CDS       T01001                                 

Gene name
KDM6A, KABUK2, UTX, bA386N14.2
Definition
(RefSeq) lysine demethylase 6A
  KO
K11447  histone demethylase [EC:1.14.11.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Disease
H00570  Kabuki syndrome
H01667  Medulloblastoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    7403 (KDM6A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    7403 (KDM6A)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     7403 (KDM6A)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HMT complexes
    MLL3/MLL4 complex
     7403 (KDM6A)
   Histone demethylases
    7403 (KDM6A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JmjC TPR_1 TPR_2 TPR_8 TPR_16 TPR_17 TPR_12 TPR_19 TPR_9 TPR_11 SNAP TPR_15 ANAPC3
Motif
Other DBs
NCBI-GeneID: 7403
NCBI-ProteinID: NP_066963
OMIM: 300128
HGNC: 12637
Ensembl: ENSG00000147050
Vega: OTTHUMG00000021402
Pharos: O15550(Tbio)
UniProt: O15550 Q59HG3
LinkDB All DBs
Structure
PDB: 

Position
Xp11.3
AA seq 1401 aa AA seqDB search
MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFV
RFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYY
SLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVN
TDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQ
VKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKV
QDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGT
LYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQAQLCNLPQGSLQNKTKLLPSIE
EAWSLPIPAELTSRQGAMNTAQQNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQHLEQL
RANRNNLNPAQKLMLEQLESQFVLMQQHQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSG
QQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITG
SGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPL
SSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKP
SGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQL
SALLMGKANNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNS
VTSLNSPHSGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKAC
RNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFC
TNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKI
WHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFK
TIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPG
SRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDL
YEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNK
LQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWH
GRTKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKM
EDLMQVYDQFTLAPPLPSASS
NT seq 4206 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctgcggagtgtcgctcgctaccgccgccgctgccgccgccgctttcggtgat
gaggaaaagaaaatggcggcgggaaaagcgagcggcgagagcgaggaggcgtcccccagc
ctgacagccgaggagagggaggcgctcggcggactggacagccgcctctttgggttcgtg
agatttcatgaagatggcgccaggacgaaggccctactgggcaaggctgttcgctgctat
gaatctctaatcttaaaagctgaaggaaaagtggagtctgatttcttttgtcaattaggt
cacttcaacctcttattggaagattatccaaaagcattatctgcataccagaggtactac
agtttacagtctgactactggaagaatgctgcctttttatatggtcttggtttggtctac
ttccattataatgcatttcagtgggcaattaaagcatttcaggaggtgctttatgttgat
cccagcttttgtcgagccaaggaaattcatttacgacttgggcttatgttcaaagtgaac
acagactatgagtctagtttaaagcattttcagttagctttggttgactgtaatccctgc
actttgtccaatgctgaaattcaatttcacattgcccacttatatgaaacccagaggaaa
tatcattctgcaaaagaagcttatgaacaacttttgcagacagagaatctttctgcacaa
gtaaaagcaactgtcttacaacagttaggttggatgcatcacactgtagatctcctggga
gataaagccaccaaggaaagctatgctattcagtatctccaaaagtccttggaagcagat
cctaattctggccagtcctggtatttcctcggaaggtgctattcaagtattgggaaagtt
caggatgcctttatatcttacaggcagtctattgataaatcagaagcaagtgcagataca
tggtgttcaataggtgtgctatatcagcagcaaaatcagcccatggatgctttacaggcc
tatatttgtgctgtacaattggaccatggccatgctgcagcctggatggacctaggcact
ctctatgaatcctgcaaccagcctcaggatgccattaaatgctacttaaatgcaactaga
agcaaaagttgtagtaatacctctgcacttgcagcacgaattaagtatttacaggctcag
ttgtgtaaccttccacaaggtagtctacagaataaaactaaattacttcctagtattgag
gaggcgtggagcctaccaattcccgcagagcttacctccaggcagggtgccatgaacaca
gcacagcagaatacttctgacaattggagtggtggacatgctgtgtcacatcctccagta
cagcaacaagctcattcatggtgtttgacaccacagaaattacagcatttggaacagctc
cgcgcaaatagaaataatttaaatccagcacagaaactgatgctggaacagctggaaagt
cagtttgtcttaatgcaacaacaccaaatgagaccaacaggagttgcacaggtacgatct
actggaattcctaatgggccaacagctgactcatcactgcctacaaactcagtctctggc
cagcagccacagcttgctctgaccagagtgcctagcgtctctcagcctggagtccgtcct
gcctgccctgggcagcctttggccaatggacccttttctgcaggccatgttccctgtagc
acatcaagaacgctgggaagtacagacactattttgataggcaataatcatataacagga
agtggaagtaatggaaacgtgccttacctgcagcgaaacgcactcactctacctcataac
cgcacaaacctgaccagcagcgcagaggagccgtggaaaaaccaactatctaactccact
caggggcttcacaaaggtcagagttcacattcggcaggtcctaatggtgaacgacctctc
tcttccactgggccttcccagcatctccaggcagctggctctggtattcagaatcagaac
ggacatcccaccctgcctagcaattcagtaacacagggggctgctctcaatcacctctcc
tctcacactgctacctcaggtggacaacaaggcattaccttaaccaaagagagcaagcct
tcaggaaacatattgacggtgcctgaaacaagcaggcacactggagagacacctaacagc
actgccagtgtcgagggacttcctaatcatgtccatcagatgacggcagatgctgtttgc
agtcctagccatggagattctaagtcaccaggtttactaagttcagacaatcctcagctc
tctgccttgttgatgggaaaagccaataacaatgtgggtactggaacctgtgacaaagtc
aataacatccacccagctgttcatacaaagactgataactctgttgcctcttcaccatct
tcagccatttcaacagcaacaccttctccaaaatccactgagcagacaaccacaaacagt
gttaccagccttaacagccctcacagtgggctacacacaattaatggagaagggatggaa
gaatctcagagccccatgaaaacagatctgcttctggttaaccacaaacctagtccacag
atcataccatcaatgtctgtgtccatataccccagctcagcagaagttctgaaggcatgc
aggaatctaggtaaaaatggcttatctaacagtagcattttgttggataaatgtccacct
ccaagaccaccatcttcaccataccctcccttgccaaaggacaagttgaatccacctaca
cctagtatttacttggaaaataaacgtgatgctttctttcctccattacatcaattttgt
acaaatccgaacaaccctgttacagtaatacgtggccttgctggagctcttaagttagac
ctgggacttttctctactaaaactttggtggaagctaacaatgaacatatggtagaagtg
aggacacagttgttgcagccagcagatgaaaactgggatcccactggaacaaagaaaatc
tggcattgtgaaagtaatagatctcatactacaattgctaaatatgcacagtaccaggcc
tcctcattccaggaatcattgagagaagaaaatgaaaaaagaagtcatcataaagaccac
tcagatagtgaatctacatcgtcagataattctgggaggaggaggaaaggaccctttaaa
accataaagtttgggaccaatattgacctatctgatgacaaaaagtggaagttgcagcta
catgagctgactaaacttcctgcttttgtgcgtgtcgtatcagcaggaaatcttctaagc
catgttggtcataccatattgggcatgaacacagttcaactatacatgaaagttccaggg
agcagaacaccaggtcatcaggaaaataacaacttctgttcagttaacataaatattggc
ccaggtgactgtgaatggtttgttgttcctgaaggttactggggtgttctgaatgacttc
tgtgaaaaaaataatttgaatttcctaatgggttcttggtggcccaatcttgaagatctt
tatgaagcaaatgttccagtgtataggtttattcagcgacctggagatttggtctggata
aatgcaggcactgttcattgggttcaggctattggctggtgcaacaacattgcttggaat
gttggtccacttacagcctgccagtataaattggcagtggaacggtacgaatggaacaaa
ttgcaaagtgtgaagtcaatagtacccatggttcatctttcctggaatatggcacgaaat
atcaaggtctcagatccaaagctttttgaaatgattaagtattgtcttctaagaactctg
aagcaatgtcagacattgagggaagctctcattgctgcaggaaaagagattatatggcat
gggcggacaaaagaagaaccagctcattactgtagcatttgtgaagtggaggtttttgat
ctgctttttgtcactaatgagagtaattcacgaaagacctacatagtacattgccaagat
tgtgcacgaaaaacaagcggaaacttggaaaactttgtggtgctagaacagtacaaaatg
gaggacctgatgcaagtctatgaccaatttacattagctcctccattaccatccgcctca
tcttga

KEGG   Homo sapiens (human): 8464Help
Entry
8464              CDS       T01001                                 

Gene name
SUPT3H, SPT3, SPT3L
Definition
(RefSeq) SPT3 homolog, SAGA and STAGA complex component
  KO
K11313  transcription initiation protein SPT3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8464 (SUPT3H)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    8464 (SUPT3H)
   03036 Chromosome and associated proteins [BR:hsa03036]
    8464 (SUPT3H)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     8464 (SUPT3H)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    PCAF complex
     8464 (SUPT3H)
    STAGA complex
     8464 (SUPT3H)
    TFTC complex
     8464 (SUPT3H)
    SAGA complex
     8464 (SUPT3H)
    SLIK complex
     8464 (SUPT3H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIID-18kDa DUF4093 Hit1_C
Motif
Other DBs
NCBI-GeneID: 8464
NCBI-ProteinID: NP_003590
OMIM: 602947
HGNC: 11466
Ensembl: ENSG00000196284
Vega: OTTHUMG00000014773
Pharos: O75486(Tbio)
UniProt: O75486 A0A024RD67
LinkDB All DBs
Position
6p21.1
AA seq 317 aa AA seqDB search
MNNTAASPMSTATSSSGRSTGKSISFATELQSMMYSLGDARRPLHETAVLVEDVVHTQLI
NLLQQAAEVSQLRGARVITPEDLLFLMRKDKKKLRRLLKYMFIRDYKSKIVKGIDEDDLL
EDKLSGSNNANKRQKIAQDFLNSIDQTGELLAMFEDDEIDEVKQERMERAERQTRIMDSA
QYAEFCESRQLSFSKKASKFRDWLDCSSMEIKPNVVAMEILAYLAYETVAQLVDLALLVR
QDMVTKAGDPFSHAISATFIQYHNSAESTAACGVEAHSDAIQPCHIREAIRRYSHRIGPL
SPFTNAYRRNGMAFLAC
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaataatacggcagctagtccaatgtctactgcaacttcaagtagtggaaggagtaca
gggaagtctataagctttgcaacagaattacagagtatgatgtattctttaggtgatgct
agaaggcctcttcatgaaacagcagttttggtagaagatgtggtacacactcagttaatt
aatctgttacagcaagctgctgaagtttctcagctgcggggagcaagggtaatcactcct
gaagatcttctgtttttgatgcgcaaagataagaaaaaacttagaagactgctaaaatac
atgtttatccgagactacaaatcaaagattgtcaaaggcatcgatgaggatgatcttctc
gaagacaaattgagtggcagcaataatgcgaacaaaagacaaaagattgctcaggacttc
ctcaactctattgaccagacaggagaacttttagcaatgtttgaagatgacgaaattgat
gaagttaaacaagaaagaatggagagagcagaaagacaaactcgaattatggattcagct
caatatgcagaattctgtgaaagtcgacaattaagtttctccaaaaaagcttccaaattt
cgagactggttggactgcagcagtatggagataaaacccaatgttgtcgcaatggaaatc
ttagcatatttagcgtatgaaactgtggcacagttagtggatctggctcttcttgtgagg
caagacatggtaaccaaggcaggggaccccttcagccatgccatttctgcaaccttcatt
cagtatcacaactctgctgagagcactgcagcctgtggtgttgaggctcacagcgatgcc
atccagccctgccacatcagagaggccattcgacgctacagccacaggattggcccactt
tccccattcacaaatgcctaccgcaggaatgggatggcttttctagcctgctga

KEGG   Homo sapiens (human): 8842Help
Entry
8842              CDS       T01001                                 

Gene name
PROM1, AC133, CD133, CORD12, MCDR2, MSTP061, PROML1, RP41, STGD4
Definition
(RefSeq) prominin 1
  KO
K06532  prominin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Disease
H00481  Cone-rod dystrophy and cone dystrophy
H00527  Retinitis pigmentosa
H00819  Stargardt disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8842 (PROM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8842 (PROM1)
   04090 CD molecules [BR:hsa04090]
    8842 (PROM1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   8842 (PROM1)
CD molecules [BR:hsa04090]
 Proteins
  8842 (PROM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Prominin Tweety Baculo_PEP_C DUF1218 HemX RasGAP_C DUF1574 RE_CfrBI Apolipoprotein TRPM_tetra AIP3 BORCS7 DUF3774 CLZ FliD_N
Motif
Other DBs
NCBI-GeneID: 8842
NCBI-ProteinID: NP_006008
OMIM: 604365
HGNC: 9454
Ensembl: ENSG00000007062
Vega: OTTHUMG00000160180
Pharos: O43490(Tbio)
UniProt: O43490
LinkDB All DBs
Position
4p15.32
AA seq 865 aa AA seqDB search
MALVLGSLLLLGLCGNSFSGGQPSSTDAPKAWNYELPATNYETQDSHKAGPIGILFELVH
IFLYVVQPRDFPEDTLRKFLQKAYESKIDYDKPETVILGLKIVYYEAGIILCCVLGLLFI
ILMPLVGYFFCMCRCCNKCGGEMHQRQKENGPFLRKCFAISLLVICIIISIGIFYGFVAN
HQVRTRIKRSRKLADSNFKDLRTLLNETPEQIKYILAQYNTTKDKAFTDLNSINSVLGGG
ILDRLRPNIIPVLDEIKSMATAIKETKEALENMNSTLKSLHQQSTQLSSSLTSVKTSLRS
SLNDPLCLVHPSSETCNSIRLSLSQLNSNPELRQLPPVDAELDNVNNVLRTDLDGLVQQG
YQSLNDIPDRVQRQTTTVVAGIKRVLNSIGSDIDNVTQRLPIQDILSAFSVYVNNTESYI
HRNLPTLEEYDSYWWLGGLVICSLLTLIVIFYYLGLLCGVCGYDRHATPTTRGCVSNTGG
VFLMVGVGLSFLFCWILMIIVVLTFVFGANVEKLICEPYTSKELFRVLDTPYLLNEDWEY
YLSGKLFNKSKMKLTFEQVYSDCKKNRGTYGTLHLQNSFNISEHLNINEHTGSISSELES
LKVNLNIFLLGAAGRKNLQDFAACGIDRMNYDSYLAQTGKSPAGVNLLSFAYDLEAKANS
LPPGNLRNSLKRDAQTIKTIHQQRVLPIEQSLSTLYQSVKILQRTGNGLLERVTRILASL
DFAQNFITNNTSSVIIEETKKYGRTIIGYFEHYLQWIEFSISEKVASCKPVATALDTAVD
VFLCSYIIDPLNLFWFGIGKATVFLLPALIFAVKLAKYYRRMDSEDVYDDVETIPMKNME
NGNNGYHKDHVYGIHNPVMTSPSQH
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atggccctcgtactcggctccctgttgctgctggggctgtgcgggaactccttttcagga
gggcagccttcatccacagatgctcctaaggcttggaattatgaattgcctgcaacaaat
tatgagacccaagactcccataaagctggacccattggcattctctttgaactagtgcat
atctttctctatgtggtacagccgcgtgatttcccagaagatactttgagaaaattctta
cagaaggcatatgaatccaaaattgattatgacaagccagaaactgtaatcttaggtcta
aagattgtctactatgaagcagggattattctatgctgtgtcctggggctgctgtttatt
attctgatgcctctggtggggtatttcttttgtatgtgtcgttgctgtaacaaatgtggt
ggagaaatgcaccagcgacagaaggaaaatgggcccttcctgaggaaatgctttgcaatc
tccctgttggtgatttgtataataataagcattggcatcttctatggttttgtggcaaat
caccaggtaagaacccggatcaaaaggagtcggaaactggcagatagcaatttcaaggac
ttgcgaactctcttgaatgaaactccagagcaaatcaaatatatattggcccagtacaac
actaccaaggacaaggcgttcacagatctgaacagtatcaattcagtgctaggaggcgga
attcttgaccgactgagacccaacatcatccctgttcttgatgagattaagtccatggca
acagcgatcaaggagaccaaagaggcgttggagaacatgaacagcaccttgaagagcttg
caccaacaaagtacacagcttagcagcagtctgaccagcgtgaaaactagcctgcggtca
tctctcaatgaccctctgtgcttggtgcatccatcaagtgaaacctgcaacagcatcaga
ttgtctctaagccagctgaatagcaaccctgaactgaggcagcttccacccgtggatgca
gaacttgacaacgttaataacgttcttaggacagatttggatggcctggtccaacagggc
tatcaatcccttaatgatatacctgacagagtacaacgccaaaccacgactgtcgtagca
ggtatcaaaagggtcttgaattccattggttcagatatcgacaatgtaactcagcgtctt
cctattcaggatatactctcagcattctctgtttatgttaataacactgaaagttacatc
cacagaaatttacctacattggaagagtatgattcatactggtggctgggtggcctggtc
atctgctctctgctgaccctcatcgtgattttttactacctgggcttactgtgtggcgtg
tgcggctatgacaggcatgccaccccgaccacccgaggctgtgtctccaacaccggaggc
gtcttcctcatggttggagttggattaagtttcctcttttgctggatattgatgatcatt
gtggttcttacctttgtctttggtgcaaatgtggaaaaactgatctgtgaaccttacacg
agcaaggaattattccgggttttggatacaccctacttactaaatgaagactgggaatac
tatctctctgggaagctatttaataaatcaaaaatgaagctcacttttgaacaagtttac
agtgactgcaaaaaaaatagaggcacttacggcactcttcacctgcagaacagcttcaat
atcagtgaacatctcaacattaatgagcatactggaagcataagcagtgaattggaaagt
ctgaaggtaaatcttaatatctttctgttgggtgcagcaggaagaaaaaaccttcaggat
tttgctgcttgtggaatagacagaatgaattatgacagctacttggctcagactggtaaa
tcccccgcaggagtgaatcttttatcatttgcatatgatctagaagcaaaagcaaacagt
ttgcccccaggaaatttgaggaactccctgaaaagagatgcacaaactattaaaacaatt
caccagcaacgagtccttcctatagaacaatcactgagcactctataccaaagcgtcaag
atacttcaacgcacagggaatggattgttggagagagtaactaggattctagcttctctg
gattttgctcagaacttcatcacaaacaatacttcctctgttattattgaggaaactaag
aagtatgggagaacaataataggatattttgaacattatctgcagtggatcgagttctct
atcagtgagaaagtggcatcgtgcaaacctgtggccaccgctctagatactgctgttgat
gtctttctgtgtagctacattatcgaccccttgaatttgttttggtttggcataggaaaa
gctactgtatttttacttccggctctaatttttgcggtaaaactggctaagtactatcgt
cgaatggattcggaggacgtgtacgatgatgttgaaactatacccatgaaaaatatggaa
aatggtaataatggttatcataaagatcatgtatatggtattcacaatcctgttatgaca
agcccatcacaacattga

KEGG   Homo sapiens (human): 2322Help
Entry
2322              CDS       T01001                                 

Gene name
FLT3, CD135, FLK-2, FLK2, STK1
Definition
(RefSeq) fms related tyrosine kinase 3
  KO
K05092  fms-related tyrosine kinase 3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
hsa05230  Central carbon metabolism in cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06219  JAK-STAT signaling
nt06240  Transcription
nt06262  Pancreatic cancer
nt06275  Acute myeloid leukemia
  Element
N00004  Duplication or mutation-activated FLT3 to RAS-ERK signaling pathway
N00031  Duplication or mutation-activated FLT3 to RAS-PI3K signaling pathway
N00054  Duplication or mutation-activated FLT3 to Jak-STAT signaling pathway
N00119  MLL-AF4 fusion to transcriptional activation
N00217  FLT3LG-FLT3-RAS-ERK signaling pathway
N00218  FLT3LG-FLT3-RAS-PI3K signaling pathway
N00219  FLT3LG-FLT3-STAT5 signaling pathway
Disease
H00003  Acute myeloid leukemia
Drug target
Cabozantinib (DG01670): D10062 D10095
Crenolanib (DG01361): D10102 D10103
Dovitinib lactate: D08907
Gilteritinib (DG01948): D10709 D10800
Lestaurtinib: D04696
Midostaurin: D05029
Quizartinib (DG01364): D09955 D09956
Semaxanib: D05819
Sorafenib (DG00713): D06272 D08524
Sunitinib (DG00712): D06402 D08552
Tandutinib: D06005
Tozasertib (DG01365): D08279 D08344
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2322 (FLT3)
   04010 MAPK signaling pathway
    2322 (FLT3)
   04151 PI3K-Akt signaling pathway
    2322 (FLT3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    2322 (FLT3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2322 (FLT3)
   05202 Transcriptional misregulation in cancer
    2322 (FLT3)
   05230 Central carbon metabolism in cancer
    2322 (FLT3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    2322 (FLT3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2322 (FLT3)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2322 (FLT3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2322 (FLT3)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   2322 (FLT3)
CD molecules [BR:hsa04090]
 Proteins
  2322 (FLT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase ig I-set Ig_3 Ig_2 Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 2322
NCBI-ProteinID: NP_004110
OMIM: 136351
HGNC: 3765
Ensembl: ENSG00000122025
Vega: OTTHUMG00000016646
Pharos: P36888(Tclin)
UniProt: P36888
LinkDB All DBs
Structure
PDB: 

Position
13q12.2
AA seq 993 aa AA seqDB search
MPALARDGGQLPLLVVFSAMIFGTITNQDLPVIKCVLINHKNNDSSVGKSSSYPMVSESP
EDLGCALRPQSSGTVYEAAAVEVDVSASITLQVLVDAPGNISCLWVFKHSSLNCQPHFDL
QNRGVVSMVILKMTETQAGEYLLFIQSEATNYTILFTVSIRNTLLYTLRRPYFRKMENQD
ALVCISESVPEPIVEWVLCDSQGESCKEESPAVVKKEEKVLHELFGTDIRCCARNELGRE
CTRLFTIDLNQTPQTTLPQLFLKVGEPLWIRCKAVHVNHGFGLTWELENKALEEGNYFEM
STYSTNRTMIRILFAFVSSVARNDTGYYTCSSSKHPSQSALVTIVEKGFINATNSSEDYE
IDQYEEFCFSVRFKAYPQIRCTWTFSRKSFPCEQKGLDNGYSISKFCNHKHQPGEYIFHA
ENDDAQFTKMFTLNIRRKPQVLAEASASQASCFSDGYPLPSWTWKKCSDKSPNCTEEITE
GVWNRKANRKVFGQWVSSSTLNMSEAIKGFLVKCCAYNSLGTSCETILLNSPGPFPFIQD
NISFYATIGVCLLFIVVLTLLICHKYKKQFRYESQLQMVQVTGSSDNEYFYVDFREYEYD
LKWEFPRENLEFGKVLGSGAFGKVMNATAYGISKTGVSIQVAVKMLKEKADSSEREALMS
ELKMMTQLGSHENIVNLLGACTLSGPIYLIFEYCCYGDLLNYLRSKREKFHRTWTEIFKE
HNFSFYPTFQSHPNSSMPGSREVQIHPDSDQISGLHGNSFHSEDEIEYENQKRLEEEEDL
NVLTFEDLLCFAYQVAKGMEFLEFKSCVHRDLAARNVLVTHGKVVKICDFGLARDIMSDS
NYVVRGNARLPVKWMAPESLFEGIYTIKSDVWSYGILLWEIFSLGVNPYPGIPVDANFYK
LIQNGFKMDQPFYATEEIYIIMQSCWAFDSRKRPSFPNLTSFLGCQLADAEEAMYQNVDG
RVSECPHTYQNRRPFSREMDLGLLSPQAQVEDS
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgttggcgcgcgacggcggccagctgccgctgctcgttgttttttctgcaatg
atatttgggactattacaaatcaagatctgcctgtgatcaagtgtgttttaatcaatcat
aagaacaatgattcatcagtggggaagtcatcatcatatcccatggtatcagaatccccg
gaagacctcgggtgtgcgttgagaccccagagctcagggacagtgtacgaagctgccgct
gtggaagtggatgtatctgcttccatcacactgcaagtgctggtcgacgccccagggaac
atttcctgtctctgggtctttaagcacagctccctgaattgccagccacattttgattta
caaaacagaggagttgtttccatggtcattttgaaaatgacagaaacccaagctggagaa
tacctactttttattcagagtgaagctaccaattacacaatattgtttacagtgagtata
agaaataccctgctttacacattaagaagaccttactttagaaaaatggaaaaccaggac
gccctggtctgcatatctgagagcgttccagagccgatcgtggaatgggtgctttgcgat
tcacagggggaaagctgtaaagaagaaagtccagctgttgttaaaaaggaggaaaaagtg
cttcatgaattatttgggacggacataaggtgctgtgccagaaatgaactgggcagggaa
tgcaccaggctgttcacaatagatctaaatcaaactcctcagaccacattgccacaatta
tttcttaaagtaggggaacccttatggataaggtgcaaagctgttcatgtgaaccatgga
ttcgggctcacctgggaattagaaaacaaagcactcgaggagggcaactactttgagatg
agtacctattcaacaaacagaactatgatacggattctgtttgcttttgtatcatcagtg
gcaagaaacgacaccggatactacacttgttcctcttcaaagcatcccagtcaatcagct
ttggttaccatcgtagaaaagggatttataaatgctaccaattcaagtgaagattatgaa
attgaccaatatgaagagttttgtttttctgtcaggtttaaagcctacccacaaatcaga
tgtacgtggaccttctctcgaaaatcatttccttgtgagcaaaagggtcttgataacgga
tacagcatatccaagttttgcaatcataagcaccagccaggagaatatatattccatgca
gaaaatgatgatgcccaatttaccaaaatgttcacgctgaatataagaaggaaacctcaa
gtgctcgcagaagcatcggcaagtcaggcgtcctgtttctcggatggatacccattacca
tcttggacctggaagaagtgttcagacaagtctcccaactgcacagaagagatcacagaa
ggagtctggaatagaaaggctaacagaaaagtgtttggacagtgggtgtcgagcagtact
ctaaacatgagtgaagccataaaagggttcctggtcaagtgctgtgcatacaattccctt
ggcacatcttgtgagacgatccttttaaactctccaggccccttccctttcatccaagac
aacatctcattctatgcaacaattggtgtttgtctcctcttcattgtcgttttaaccctg
ctaatttgtcacaagtacaaaaagcaatttaggtatgaaagccagctacagatggtacag
gtgaccggctcctcagataatgagtacttctacgttgatttcagagaatatgaatatgat
ctcaaatgggagtttccaagagaaaatttagagtttgggaaggtactaggatcaggtgct
tttggaaaagtgatgaacgcaacagcttatggaattagcaaaacaggagtctcaatccag
gttgccgtcaaaatgctgaaagaaaaagcagacagctctgaaagagaggcactcatgtca
gaactcaagatgatgacccagctgggaagccacgagaatattgtgaacctgctgggggcg
tgcacactgtcaggaccaatttacttgatttttgaatactgttgctatggtgatcttctc
aactatctaagaagtaaaagagaaaaatttcacaggacttggacagagattttcaaggaa
cacaatttcagtttttaccccactttccaatcacatccaaattccagcatgcctggttca
agagaagttcagatacacccggactcggatcaaatctcagggcttcatgggaattcattt
cactctgaagatgaaattgaatatgaaaaccaaaaaaggctggaagaagaggaggacttg
aatgtgcttacatttgaagatcttctttgctttgcatatcaagttgccaaaggaatggaa
tttctggaatttaagtcgtgtgttcacagagacctggccgccaggaacgtgcttgtcacc
cacgggaaagtggtgaagatatgtgactttggattggctcgagatatcatgagtgattcc
aactatgttgtcaggggcaatgcccgtctgcctgtaaaatggatggcccccgaaagcctg
tttgaaggcatctacaccattaagagtgatgtctggtcatatggaatattactgtgggaa
atcttctcacttggtgtgaatccttaccctggcattccggttgatgctaacttctacaaa
ctgattcaaaatggatttaaaatggatcagccattttatgctacagaagaaatatacatt
ataatgcaatcctgctgggcttttgactcaaggaaacggccatccttccctaatttgact
tcgtttttaggatgtcagctggcagatgcagaagaagcgatgtatcagaatgtggatggc
cgtgtttcggaatgtcctcacacctaccaaaacaggcgacctttcagcagagagatggat
ttggggctactctctccgcaggctcaggtcgaagattcgtag

KEGG   Homo sapiens (human): 55589Help
Entry
55589             CDS       T01001                                 

Gene name
BMP2K, BIKE, HRIHFB2017
Definition
(RefSeq) BMP2 inducible kinase
  KO
K08854  BMP2 inducible kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    55589 (BMP2K)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    55589 (BMP2K)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     55589 (BMP2K)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  NAK family [OT]
   55589 (BMP2K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BMP2K_C Pkinase Pkinase_Tyr Pkinase_fungal
Motif
Other DBs
NCBI-GeneID: 55589
NCBI-ProteinID: NP_942595
OMIM: 617648
HGNC: 18041
Ensembl: ENSG00000138756
Vega: OTTHUMG00000160900
Pharos: Q9NSY1(Tchem)
UniProt: Q9NSY1
LinkDB All DBs
Structure
PDB: 

Position
4q21.21
AA seq 1161 aa AA seqDB search
MKKFSRMPKSEGGSGGGAAGGGAGGAGAGAGCGSGGSSVGVRVFAVGRHQVTLEESLAEG
GFSTVFLVRTHGGIRCALKRMYVNNMPDLNVCKREITIMKELSGHKNIVGYLDCAVNSIS
DNVWEVLILMEYCRAGQVVNQMNKKLQTGFTEPEVLQIFCDTCEAVARLHQCKTPIIHRD
LKVENILLNDGGNYVLCDFGSATNKFLNPQKDGVNVVEEEIKKYTTLSYRAPEMINLYGG
KPITTKADIWALGCLLYKLCFFTLPFGESQVAICDGNFTIPDNSRYSRNIHCLIRFMLEP
DPEHRPDIFQVSYFAFKFAKKDCPVSNINNSSIPSALPEPMTASEAAARKSQIKARITDT
IGPTETSIAPRQRPKANSATTATPSVLTIQSSATPVKVLAPGEFGNHRPKGALRPGNGPE
ILLGQGPPQQPPQQHRVLQQLQQGDWRLQQLHLQHRHPHQQQQQQQQQQQQQQQQQQQQQ
QQQQQQHHHHHHHHLLQDAYMQQYQHATQQQQMLQQQFLMHSVYQPQPSASQYPTMMPQY
QQAFFQQQMLAQHQPSQQQASPEYLTSPQEFSPALVSYTSSLPAQVGTIMDSSYSANRSV
ADKEAIANFTNQKNISNPPDMSGWNPFGEDNFSKLTEEELLDREFDLLRSNRLEERASSD
KNVDSLSAPHNHPPEDPFGSVPFISHSGSPEKKAEHSSINQENGTANPIKNGKTSPASKD
QRTGKKTSVQGQVQKGNDESESDFESDPPSPKSSEEEEQDDEEVLQGEQGDFNDDDTEPE
NLGHRPLLMDSEDEEEEEKHSSDSDYEQAKAKYSDMSSVYRDRSGSGPTQDLNTILLTSA
QLSSDVAVETPKQEFDVFGAVPFFAVRAQQPQQEKNEKNLPQHRFPAAGLEQEEFDVFTK
APFSKKVNVQECHAVGPEAHTIPGYPKSVDVFGSTPFQPFLTSTSKSESNEDLFGLVPFD
EITGSQQQKVKQRSLQKLSSRQRRTKQDMSKSNGKRHHGTPTSTKKTLKPTYRTPERARR
HKKVGRRDSQSSNEFLTISDSKENISVALTDGKDRGNVLQPEESLLDPFGAKPFHSPDLS
WHPPHQGLSDIRADHNTVLPGRPRQNSLHGSFHSADVLKMDDFGAVPFTELVVQSITPHQ
SQQSQPVELDPFGAAPFPSKQ
NT seq 3486 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagttctctcggatgcccaagtcggagggcggcagcggcggcggagcggcgggt
ggcggggctggcggggccggggccggggccggctgcggctccggcggctcgtccgtgggg
gtccgggtgttcgcggtcggccgccaccaggtcaccctggaagagtcgctggccgaaggt
ggattctccacagttttcctcgtgcgtactcacggtggaatccgatgtgcattgaagcga
atgtatgtcaataacatgccagacctcaatgtttgtaaaagggaaattacaattatgaaa
gagctatctggtcacaaaaatattgtgggctatttggactgtgctgttaattcaattagt
gataatgtatgggaagtccttatcttaatggaatattgtcgagctggacaggtagtgaat
caaatgaataagaagctacagacgggttttacagaaccagaagtgttacagatattctgt
gatacctgtgaagctgttgcaaggttgcatcagtgtaagactccaataattcaccgggat
ctgaaggtagaaaatattttgttgaatgatggtgggaactatgtactttgtgactttggc
agtgccactaataaatttcttaatcctcaaaaagatggagttaatgtagtagaagaagaa
attaaaaagtatacaactctgtcatacagagcccctgaaatgatcaacctttatggaggg
aaacccatcaccaccaaggctgatatctgggcactgggatgtctactctataaactttgt
ttcttcactcttccttttggtgagagtcaggttgctatctgtgatggcaacttcaccatc
ccagacaattctcgttactcccgtaacatacattgcttaataaggttcatgcttgaacca
gatccggaacatagacctgatatatttcaagtgtcatattttgcatttaaatttgccaaa
aaggattgtccagtctccaacatcaataattcttctattccttcagctcttcctgaaccg
atgactgctagtgaagcagctgctaggaaaagccaaataaaagccagaataacagatacc
attggaccaacagaaacctcaattgcaccaagacaaagaccaaaggccaactctgctact
actgccactcccagtgtgctgaccattcaaagttcagcaacacctgttaaagtccttgct
cctggtgaattcggtaaccatagaccaaaaggggcactaagacctggaaatggccctgaa
attttattgggtcagggacctcctcagcagccgccacagcagcatagagtactccagcaa
ctacagcagggagattggagattacagcaactccatttacagcatcgtcatcctcaccag
cagcagcagcagcagcagcagcaacagcaacagcagcagcagcaacagcaacagcagcag
cagcagcagcagcagcagcaccaccaccaccaccaccaccacctacttcaagatgcttat
atgcagcagtatcaacatgcaacacagcagcaacagatgcttcaacaacaatttttaatg
cattcggtatatcaaccacaaccttctgcatcacagtatcctacaatgatgccgcagtat
cagcaggctttctttcaacagcagatgctagctcaacatcagccgtctcaacaacaggca
tcacctgaatatcttacctcccctcaagagttctcaccagccttagtttcctacacttca
tcacttccagctcaggttggaaccataatggactcctcctatagtgccaataggtcagtt
gctgataaagaggccattgcaaatttcacaaatcagaagaacatcagcaatccacctgat
atgtcagggtggaatccttttggagaggataatttctctaagttaacagaagaggaacta
ttggacagagaatttgaccttctaagatcaaataggctcgaggagagagcatcctcagat
aagaatgtagactcactttctgctccacataaccatcctccagaagatccttttggttct
gttcctttcatttctcattcaggttctcctgaaaagaaagctgaacattcatctataaat
caagaaaatggcactgcaaaccctatcaagaacggtaaaacaagtccagcatctaaagat
cagcggactggaaagaaaacctcagtacagggtcaagtgcaaaaggggaatgatgaatct
gaaagtgattttgaatcagatcccccttctcctaagagcagtgaagaggaagagcaagat
gatgaagaagttcttcagggggaacaaggagattttaatgatgatgatactgaaccagaa
aatctgggtcataggcctctcctcatggattctgaagatgaggaagaagaggagaaacat
agctctgattctgattatgagcaggctaaagcaaagtacagtgacatgagctctgtctac
agagacagatctggcagtggaccaacccaagatcttaatacaatactcctcacctcagcc
caattatcctctgatgttgcagtggagactcccaaacaggagtttgatgtatttggcgct
gtccccttctttgcagtgcgtgctcaacagccccagcaagaaaagaatgaaaagaacctc
cctcaacacaggtttcctgctgcaggactggagcaggaggaatttgatgtattcacaaag
gcgccttttagcaagaaggtgaatgtacaagaatgccatgcagtggggcctgaggcacat
actatccctggttatcccaaaagtgtagatgtatttggctccactccatttcagcccttc
ctcacatcaacaagtaaaagtgaaagcaatgaggacctttttgggcttgtgccctttgat
gaaataacggggagccagcagcaaaaagtcaaacagcgcagcttacagaaactgtcctct
cgccaaaggcgcacaaagcaggatatgtccaaaagtaatgggaagcggcatcatggcacg
ccaactagcacaaagaagactttgaagcctacctatcgcactccagagagggctcgcagg
cacaaaaaagtgggccgccgagactctcaaagtagcaatgaatttttaaccatctcagac
tccaaggagaacattagtgttgcactgactgatgggaaagatagggggaatgtcttacaa
cctgaggagagcctgttggaccccttcggtgccaagcccttccattctccagacctgtca
tggcaccctccacatcagggcctgagcgacatccgtgctgatcacaatactgtcctgcca
gggcggccaagacaaaattcactacatgggtcattccatagtgcagatgtattgaaaatg
gatgattttggtgccgtgccctttacagaacttgtggtgcaaagcatcactccacatcag
tcccaacagtcccaaccagtcgaattagacccatttggtgctgctccatttccttctaaa
cagtag

KEGG   Homo sapiens (human): 3480Help
Entry
3480              CDS       T01001                                 

Gene name
IGF1R, CD221, IGFIR, IGFR, JTK13
Definition
(RefSeq) insulin like growth factor 1 receptor
  KO
K05087  insulin-like growth factor 1 receptor [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04114  Oocyte meiosis
hsa04140  Autophagy - animal
hsa04144  Endocytosis
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04730  Long-term depression
hsa04913  Ovarian steroidogenesis
hsa04914  Progesterone-mediated oocyte maturation
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
Network
nt06114  PI3K signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06210  ERK signaling
nt06214  PI3K signaling
nt06240  Transcription
nt06263  Hepatocellular carcinoma
  Element
N00119  MLL-AF4 fusion to transcriptional activation
N00182  IGF-IGFR-PI3K-NFKB signaling pathway
N00233  IGF2-IGF1R-RAS-ERK signaling pathway
N00234  IGF2-IGF1R-PI3K signaling pathway
N00235  IGF2-overexpression to RAS-ERK signaling pathway
N00236  IGF2-overexpression to PI3K signaling pathway
N00237  IGF1R-overexpression to RAS-ERK signaling pathway
N00238  IGF1R-overexpression to PI3K signaling pathway
N00582  IGF-IGF1R-PI3K signaling pathway
Disease
H00015  Malignant pleural mesothelioma
H00048  Hepatocellular carcinoma
H00050  Synovial sarcoma
H01274  Growth delay due to insulin-like growth factor I resistance
Drug target
Cixutumumab: D09328
Dalotuzumab: D09746
Figitumumab: D09345
Ganitumab: D09908
Ibutamoren mesylate: D04491
Istiratumab: D10943
Linsitinib: D09925
Mecasermin: D03297
Mecasermin rinfabate: D04870
Robatumumab: D10056
Teprotumumab: D09680
Toremifene (DG00735): D00967 D08620
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    3480 (IGF1R)
   04015 Rap1 signaling pathway
    3480 (IGF1R)
   04010 MAPK signaling pathway
    3480 (IGF1R)
   04066 HIF-1 signaling pathway
    3480 (IGF1R)
   04068 FoxO signaling pathway
    3480 (IGF1R)
   04151 PI3K-Akt signaling pathway
    3480 (IGF1R)
   04152 AMPK signaling pathway
    3480 (IGF1R)
   04150 mTOR signaling pathway
    3480 (IGF1R)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    3480 (IGF1R)
   04140 Autophagy - animal
    3480 (IGF1R)
  09143 Cell growth and death
   04114 Oocyte meiosis
    3480 (IGF1R)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    3480 (IGF1R)
   04520 Adherens junction
    3480 (IGF1R)
   04550 Signaling pathways regulating pluripotency of stem cells
    3480 (IGF1R)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    3480 (IGF1R)
   04914 Progesterone-mediated oocyte maturation
    3480 (IGF1R)
  09156 Nervous system
   04730 Long-term depression
    3480 (IGF1R)
  09149 Aging
   04211 Longevity regulating pathway
    3480 (IGF1R)
   04213 Longevity regulating pathway - multiple species
    3480 (IGF1R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    3480 (IGF1R)
   05202 Transcriptional misregulation in cancer
    3480 (IGF1R)
   05205 Proteoglycans in cancer
    3480 (IGF1R)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    3480 (IGF1R)
   05214 Glioma
    3480 (IGF1R)
   05218 Melanoma
    3480 (IGF1R)
   05215 Prostate cancer
    3480 (IGF1R)
   05224 Breast cancer
    3480 (IGF1R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    3480 (IGF1R)
   01522 Endocrine resistance
    3480 (IGF1R)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3480 (IGF1R)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    3480 (IGF1R)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     3480 (IGF1R)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  INSR family [OT]
   3480 (IGF1R)
CD molecules [BR:hsa04090]
 Proteins
  3480 (IGF1R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain Pkinase Furin-like fn3 Kinase-like Insulin_TMD DUF4476
Motif
Other DBs
NCBI-GeneID: 3480
NCBI-ProteinID: NP_000866
OMIM: 147370
HGNC: 5465
Ensembl: ENSG00000140443
Vega: OTTHUMG00000149851
Pharos: P08069(Tclin)
UniProt: P08069
LinkDB All DBs
Structure
PDB: 

Position
15q26.3
AA seq 1367 aa AA seqDB search
MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCS
APDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRH
NYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHR
KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
EIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRH
SGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC
NT seq 4104 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcctgtttctctcc
gccgcgctctcgctctggccgacgagtggagaaatctgcgggccaggcatcgacatccgc
aacgactatcagcagctgaagcgcctggagaactgcacggtgatcgagggctacctccac
atcctgctcatctccaaggccgaggactaccgcagctaccgcttccccaagctcacggtc
attaccgagtacttgctgctgttccgagtggctggcctcgagagcctcggagacctcttc
cccaacctcacggtcatccgcggctggaaactcttctacaactacgccctggtcatcttc
gagatgaccaatctcaaggatattgggctttacaacctgaggaacattactcggggggcc
atcaggattgagaaaaatgctgacctctgttacctctccactgtggactggtccctgatc
ctggatgcggtgtccaataactacattgtggggaataagcccccaaaggaatgtggggac
ctgtgtccagggaccatggaggagaagccgatgtgtgagaagaccaccatcaacaatgag
tacaactaccgctgctggaccacaaaccgctgccagaaaatgtgcccaagcacgtgtggg
aagcgggcgtgcaccgagaacaatgagtgctgccaccccgagtgcctgggcagctgcagc
gcgcctgacaacgacacggcctgtgtagcttgccgccactactactatgccggtgtctgt
gtgcctgcctgcccgcccaacacctacaggtttgagggctggcgctgtgtggaccgtgac
ttctgcgccaacatcctcagcgccgagagcagcgactccgaggggtttgtgatccacgac
ggcgagtgcatgcaggagtgcccctcgggcttcatccgcaacggcagccagagcatgtac
tgcatcccttgtgaaggtccttgcccgaaggtctgtgaggaagaaaagaaaacaaagacc
attgattctgttacttctgctcagatgctccaaggatgcaccatcttcaagggcaatttg
ctcattaacatccgacgggggaataacattgcttcagagctggagaacttcatggggctc
atcgaggtggtgacgggctacgtgaagatccgccattctcatgccttggtctccttgtcc
ttcctaaaaaaccttcgcctcatcctaggagaggagcagctagaagggaattactccttc
tacgtcctcgacaaccagaacttgcagcaactgtgggactgggaccaccgcaacctgacc
atcaaagcagggaaaatgtactttgctttcaatcccaaattatgtgtttccgaaatttac
cgcatggaggaagtgacggggactaaagggcgccaaagcaaaggggacataaacaccagg
aacaacggggagagagcctcctgtgaaagtgacgtcctgcatttcacctccaccaccacg
tcgaagaatcgcatcatcataacctggcaccggtaccggccccctgactacagggatctc
atcagcttcaccgtttactacaaggaagcaccctttaagaatgtcacagagtatgatggg
caggatgcctgcggctccaacagctggaacatggtggacgtggacctcccgcccaacaag
gacgtggagcccggcatcttactacatgggctgaagccctggactcagtacgccgtttac
gtcaaggctgtgaccctcaccatggtggagaacgaccatatccgtggggccaagagtgag
atcttgtacattcgcaccaatgcttcagttccttccattcccttggacgttctttcagca
tcgaactcctcttctcagttaatcgtgaagtggaaccctccctctctgcccaacggcaac
ctgagttactacattgtgcgctggcagcggcagcctcaggacggctacctttaccggcac
aattactgctccaaagacaaaatccccatcaggaagtatgccgacggcaccatcgacatt
gaggaggtcacagagaaccccaagactgaggtgtgtggtggggagaaagggccttgctgc
gcctgccccaaaactgaagccgagaagcaggccgagaaggaggaggctgaataccgcaaa
gtctttgagaatttcctgcacaactccatcttcgtgcccagacctgaaaggaagcggaga
gatgtcatgcaagtggccaacaccaccatgtccagccgaagcaggaacaccacggccgca
gacacctacaacatcaccgacccggaagagctggagacagagtaccctttctttgagagc
agagtggataacaaggagagaactgtcatttctaaccttcggcctttcacattgtaccgc
atcgatatccacagctgcaaccacgaggctgagaagctgggctgcagcgcctccaacttc
gtctttgcaaggactatgcccgcagaaggagcagatgacattcctgggccagtgacctgg
gagccaaggcctgaaaactccatctttttaaagtggccggaacctgagaatcccaatgga
ttgattctaatgtatgaaataaaatacggatcacaagttgaggatcagcgagaatgtgtg
tccagacaggaatacaggaagtatggaggggccaagctaaaccggctaaacccggggaac
tacacagcccggattcaggccacatctctctctgggaatgggtcgtggacagatcctgtg
ttcttctatgtccaggccaaaacaggatatgaaaacttcatccatctgatcatcgctctg
cccgtcgctgtcctgttgatcgtgggagggttggtgattatgctgtacgtcttccataga
aagagaaataacagcaggctggggaatggagtgctgtatgcctctgtgaacccggagtac
ttcagcgctgctgatgtgtacgttcctgatgagtgggaggtggctcgggagaagatcacc
atgagccgggaacttgggcaggggtcgtttgggatggtctatgaaggagttgccaagggt
gtggtgaaagatgaacctgaaaccagagtggccattaaaacagtgaacgaggccgcaagc
atgcgtgagaggattgagtttctcaacgaagcttctgtgatgaaggagttcaattgtcac
catgtggtgcgattgctgggtgtggtgtcccaaggccagccaacactggtcatcatggaa
ctgatgacacggggcgatctcaaaagttatctccggtctctgaggccagaaatggagaat
aatccagtcctagcacctccaagcctgagcaagatgattcagatggccggagagattgca
gacggcatggcatacctcaacgccaataagttcgtccacagagaccttgctgcccggaat
tgcatggtagccgaagatttcacagtcaaaatcggagattttggtatgacgcgagatatc
tatgagacagactattaccggaaaggagggaaagggctgctgcccgtgcgctggatgtct
cctgagtccctcaaggatggagtcttcaccacttactcggacgtctggtccttcggggtc
gtcctctgggagatcgccacactggccgagcagccctaccagggcttgtccaacgagcaa
gtccttcgcttcgtcatggagggcggccttctggacaagccagacaactgtcctgacatg
ctgtttgaactgatgcgcatgtgctggcagtataaccccaagatgaggccttccttcctg
gagatcatcagcagcatcaaagaggagatggagcctggcttccgggaggtctccttctac
tacagcgaggagaacaagctgcccgagccggaggagctggacctggagccagagaacatg
gagagcgtccccctggacccctcggcctcctcgtcctccctgccactgcccgacagacac
tcaggacacaaggccgagaacggccccggccctggggtgctggtcctccgcgccagcttc
gacgagagacagccttacgcccacatgaacgggggccgcaagaacgagcgggccttgccg
ctgccccagtcttcgacctgctga

KEGG   Homo sapiens (human): 1027Help
Entry
1027              CDS       T01001                                 

Gene name
CDKN1B, CDKN4, KIP1, MEN1B, MEN4, P27KIP1
Definition
(RefSeq) cyclin dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04012  ErbB signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04068  FoxO signaling pathway
hsa04110  Cell cycle
hsa04151  PI3K-Akt signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa04934  Cushing syndrome
hsa05162  Measles
hsa05165  Human papillomavirus infection
hsa05169  Epstein-Barr virus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05203  Viral carcinogenesis
hsa05206  MicroRNAs in cancer
hsa05215  Prostate cancer
hsa05220  Chronic myeloid leukemia
hsa05222  Small cell lung cancer
hsa05226  Gastric cancer
Network
nt06130  Cell cycle (virus)
nt06165  Epstein-Barr virus (EBV)
nt06166  Human papillomavirus (HPV)
nt06230  Cell cycle G1/S
nt06240  Transcription
nt06261  Gastric cancer
nt06267  Small cell lung cancer
nt06272  Prostate cancer
nt06319  AHR-cell cycle regulation
nt06360  Cushing syndrome
  Element
N00091  p27-Cell cycle G1/S
N00092  Amplified MYC to p27-cell cycle G1/S
N00093  Loss of CDKN1B to p27-cell cycle G1/S
N00119  MLL-AF4 fusion to transcriptional activation
N00254  CDKN1B-reduced expression to p27-cell cycle G1/S
N00264  EBV EBNA3C to p27-Cell cycle G1/S
N00290  Mutation-inactivated MEN1 to transcription
N00316  Mutation-inactivated CDKN1B to p27-cell cycle G1/S
N00317  Aryl hydrocarbon receptor signaling pathway
N00359  HPV E7 to p27-cell cycle G1/S
N00362  HPV E5 to p21-cell cycle G1/S
Disease
H00018  Gastric cancer
H00024  Prostate cancer
H00247  Multiple endocrine neoplasia syndrome
H01102  Pituitary adenomas
H01431  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    1027 (CDKN1B)
   04066 HIF-1 signaling pathway
    1027 (CDKN1B)
   04068 FoxO signaling pathway
    1027 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    1027 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    1027 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1027 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    1027 (CDKN1B)
   05206 MicroRNAs in cancer
    1027 (CDKN1B)
   05203 Viral carcinogenesis
    1027 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    1027 (CDKN1B)
   05220 Chronic myeloid leukemia
    1027 (CDKN1B)
   05215 Prostate cancer
    1027 (CDKN1B)
   05222 Small cell lung cancer
    1027 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    1027 (CDKN1B)
   04934 Cushing syndrome
    1027 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    1027 (CDKN1B)
   05169 Epstein-Barr virus infection
    1027 (CDKN1B)
   05165 Human papillomavirus infection
    1027 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    1027 (CDKN1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CDI Multi-haem_cyto
Motif
Other DBs
NCBI-GeneID: 1027
NCBI-ProteinID: NP_004055
OMIM: 600778
HGNC: 1785
Ensembl: ENSG00000111276
Vega: OTTHUMG00000149914
Pharos: P46527(Tbio)
UniProt: P46527 Q6I9V6
LinkDB All DBs
Structure
PDB: 

Position
12p13.1
AA seq 198 aa AA seqDB search
MSNVRVSNGSPSLERMDARQAEHPKPSACRNLFGPVDHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKGSLPEFYYRPPRPPKGACKVPAQESQDVSGSRPAAPLIG
APANSEDTHLVDPKTDPSDSQTGLAEQCAGIRKRPATDDSSTQNKRANRTEENVSDGSPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagccctagcctggagcggatggacgccaggcag
gcggagcaccccaagccctcggcctgcaggaacctcttcggcccggtggaccacgaagag
ttaacccgggacttggagaagcactgcagagacatggaagaggcgagccagcgcaagtgg
aatttcgattttcagaatcacaaacccctagagggcaagtacgagtggcaagaggtggag
aagggcagcttgcccgagttctactacagacccccgcggccccccaaaggtgcctgcaag
gtgccggcgcaggagagccaggatgtcagcgggagccgcccggcggcgcctttaattggg
gctccggctaactctgaggacacgcatttggtggacccaaagactgatccgtcggacagc
cagacggggttagcggagcaatgcgcaggaataaggaagcgacctgcaaccgacgattct
tctactcaaaacaaaagagccaacagaacagaagaaaatgtttcagacggttccccaaat
gccggttctgtggagcagacgcccaagaagcctggcctcagaagacgtcaaacgtaa

KEGG   Homo sapiens (human): 5218Help
Entry
5218              CDS       T01001                                 

Gene name
CDK14, PFTAIRE1, PFTK1
Definition
(RefSeq) cyclin dependent kinase 14
  KO
K08821  cyclin-dependent kinase 14 [EC:2.7.11.22]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    5218 (CDK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5218 (CDK14)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.22  cyclin-dependent kinase
     5218 (CDK14)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CMGC group
  CDK family
   5218 (CDK14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like APH TruB_C_2
Motif
Other DBs
NCBI-GeneID: 5218
NCBI-ProteinID: NP_001274064
OMIM: 610679
HGNC: 8883
Ensembl: ENSG00000058091
Vega: OTTHUMG00000023649
Pharos: O94921(Tchem)
UniProt: O94921
LinkDB All DBs
Position
7q21.13
AA seq 469 aa AA seqDB search
MCDLIEPQPAEKIGKMKKLRRTLSESFSRIALKKDDTTFDEICVTKMSTRNCQGMDSVIK
PLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSS
PSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNGKLVALKVIRLQEEEGTPFTAIR
EASLLKGLKHANIVLLHDIIHTKETLTLVFEYVHTDLCQYMDKHPGGLHPDNVKLFLFQL
LRGLSYIHQRYILHRDLKPQNLLISDTGELKLADFGLARAKSVPSHTYSNEVVTLWYRPP
DVLLGSTEYSTCLDMWGVGCIFVEMIQGVAAFPGMKDIQDQLERIFLVLGTPNEDTWPGV
HSLPHFKPERFTLYSSKNLRQAWNKLSYVNHAEDLASKLLQCSPKNRLSAQAALSHEYFS
DLPPRLWELTDMSSIFTVPNVRLQPEAGESMRAFGKNNSYGKSLSNSKH
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgacctcattgagccgcagccggccgagaagatcggcaagatgaagaagttgcgg
agaactttgtcggagagtttcagtcgcattgctttgaagaaagatgacaccacctttgat
gagatatgtgtcacaaagatgtctacacggaactgccagggaatggactcagtgatcaaa
cccctggacacaattcctgaggataaaaaagtcagagttcagaggacacagagcactttt
gacccatttgagaaaccagctaatcaagtaaagagggtgcattctgagaacaatgcttgc
attaactttaagacctcctccactggcaaagagtcacctaaagttaggcggcactccagc
cccagctcgccaacaagtcccaaatttggaaaagctgactcatatgaaaagctggaaaaa
ctaggggaaggatcttatgctacagtatacaaagggaaaagcaaggtaaatgggaagttg
gtagctctgaaggtgatcaggctgcaggaagaagaagggacacctttcacagctatcagg
gaagcttctcttttaaaaggactaaaacatgctaacatagtgctacttcatgacatcatc
cataccaaggagacgctgacacttgtgtttgaatatgtgcacactgatttatgtcagtac
atggacaagcaccctggggggctgcatccagataatgtgaagttgtttttatttcagttg
ctgcgaggtctgtcttacatccaccagcgttatattttgcacagagacctgaaaccacag
aaccttctgatcagtgacacgggggagttaaagctggcagatttcggtcttgcaagagca
aaatccgtccctagccacacatactccaacgaagtggttaccttgtggtacagacctcca
gatgtccttctaggctcaacagaatattccacctgccttgacatgtggggagtaggttgc
atctttgttgaaatgatccaaggagttgctgcttttccaggaatgaaagacattcaggat
caacttgaacgaatatttctggttcttggaacaccaaatgaggacacatggcctggagtt
cattctttaccacattttaagccagaacgctttaccctgtacagctctaaaaaccttaga
caagcatggaataagctcagctatgtgaaccatgcagaggacctggcctccaagctccta
caatgttccccaaagaacagactgtcggcacaggctgccttgagccacgagtattttagt
gacctgccgccacggctatgggaactcaccgacatgtcttctatttttactgtcccaaat
gtgagattgcaaccagaagctggagaaagcatgcgggcctttgggaaaaacaatagttat
ggcaaaagtctatcaaacagcaagcactga

DBGET integrated database retrieval system