KEGG   Homo sapiens (human): 4023Help
Entry
4023              CDS       T01001                                 

Gene name
LPL, HDLCQ11, LIPD
Definition
(RefSeq) lipoprotein lipase
  KO
K01059  lipoprotein lipase [EC:3.1.1.34]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00561  Glycerolipid metabolism
hsa01100  Metabolic pathways
hsa03320  PPAR signaling pathway
hsa04979  Cholesterol metabolism
hsa05010  Alzheimer's disease
Disease
H00154  Hyperlipoproteinemia, type I
H01635  Hyperlipidemia
H01637  Hypertriglyceridemia
H01784  Primary hyperchylomicronemia
Drug target
Dextran (DG00180): D02047 D03343
Elastase ES: D04268
Ibrolipim: D03747
Omega-3-acid ethyl esters: D05255
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    4023 (LPL)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    4023 (LPL)
  Digestive system
   04979 Cholesterol metabolism
    4023 (LPL)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    4023 (LPL)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.34  lipoprotein lipase
     4023 (LPL)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   4023 (LPL)
  Exosomal proteins of breast milk
   4023 (LPL)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Enzymes (General comment) Variety
   4023 (LPL)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  4023 (LPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase PLAT Abhydrolase_6 Abhydrolase_1 NAGLU
Motif
Other DBs
NCBI-GeneID: 4023
NCBI-ProteinID: NP_000228
OMIM: 609708
HGNC: 6677
Ensembl: ENSG00000175445
Vega: OTTHUMG00000036645
Pharos: P06858(Tchem)
UniProt: P06858 A0A1B1RVA9
LinkDB All DBs
Position
8p21.3
AA seq 475 aa AA seqDB search
MESKALLVLTLAVWLQSLTASRGGVAAADQRRDFIDIESKFALRTPEDTAEDTCHLIPGV
AESVATCHFNHSSKTFMVIHGWTVTGMYESWVPKLVAALYKREPDSNVIVVDWLSRAQEH
YPVSAGYTKLVGQDVARFINWMEEEFNYPLDNVHLLGYSLGAHAAGIAGSLTNKKVNRIT
GLDPAGPNFEYAEAPSRLSPDDADFVDVLHTFTRGSPGRSIGIQKPVGHVDIYPNGGTFQ
PGCNIGEAIRVIAERGLGDVDQLVKCSHERSIHLFIDSLLNEENPSKAYRCSSKEAFEKG
LCLSCRKNRCNNLGYEINKVRAKRSSKMYLKTRSQMPYKVFHYQVKIHFSGTESETHTNQ
AFEISLYGTVAESENIPFTLPEVSTNKTYSFLIYTEVDIGELLMLKLKWKSDSYFSWSDW
WSSPGFAIQKIRVKAGETQKKVIFCSREKVSHLQKGKAPAVFVKCHDKSLNKKSG
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggagagcaaagccctgctcgtgctgactctggccgtgtggctccagagtctgaccgcc
tcccgcggaggggtggccgccgccgaccaaagaagagattttatcgacatcgaaagtaaa
tttgccctaaggacccctgaagacacagctgaggacacttgccacctcattcccggagta
gcagagtccgtggctacctgtcatttcaatcacagcagcaaaaccttcatggtgatccat
ggctggacggtaacaggaatgtatgagagttgggtgccaaaacttgtggccgccctgtac
aagagagaaccagactccaatgtcattgtggtggactggctgtcacgggctcaggagcat
tacccagtgtccgcgggctacaccaaactggtgggacaggatgtggcccggtttatcaac
tggatggaggaggagtttaactaccctctggacaatgtccatctcttgggatacagcctt
ggagcccatgctgctggcattgcaggaagtctgaccaataagaaagtcaacagaattact
ggcctcgatccagctggacctaactttgagtatgcagaagccccgagtcgtctttctcct
gatgatgcagattttgtagacgtcttacacacattcaccagagggtcccctggtcgaagc
attggaatccagaaaccagttgggcatgttgacatttacccgaatggaggtacttttcag
ccaggatgtaacattggagaagctatccgcgtgattgcagagagaggacttggagatgtg
gaccagctagtgaagtgctcccacgagcgctccattcatctcttcatcgactctctgttg
aatgaagaaaatccaagtaaggcctacaggtgcagttccaaggaagcctttgagaaaggg
ctctgcttgagttgtagaaagaaccgctgcaacaatctgggctatgagatcaataaagtc
agagccaaaagaagcagcaaaatgtacctgaagactcgttctcagatgccctacaaagtc
ttccattaccaagtaaagattcatttttctgggactgagagtgaaacccataccaatcag
gcctttgagatttctctgtatggcaccgtggccgagagtgagaacatcccattcactctg
cctgaagtttccacaaataagacctactccttcctaatttacacagaggtagatattgga
gaactactcatgttgaagctcaaatggaagagtgattcatactttagctggtcagactgg
tggagcagtcccggcttcgccattcagaagatcagagtaaaagcaggagagactcagaaa
aaggtgatcttctgttctagggagaaagtgtctcatttgcagaaaggaaaggcacctgcg
gtatttgtgaaatgccatgacaagtctctgaataagaagtcaggctga

DBGET integrated database retrieval system