KEGG   Homo sapiens (human): 4055Help
Entry
4055              CDS       T01001                                 

Gene name
LTBR, D12S370, LT-BETA-R, TNF-R-III, TNFCR, TNFR-RP, TNFR2-RP, TNFR3, TNFRSF3
Definition
(RefSeq) lymphotoxin beta receptor
  KO
K03159  lymphotoxin beta receptor TNFR superfamily member 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04061  Viral protein interaction with cytokine and cytokine receptor
hsa04064  NF-kappa B signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04672  Intestinal immune network for IgA production
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    4055 (LTBR)
   04066 HIF-1 signaling pathway
    4055 (LTBR)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4055 (LTBR)
   04061 Viral protein interaction with cytokine and cytokine receptor
    4055 (LTBR)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    4055 (LTBR)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    4055 (LTBR)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4055 (LTBR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    4055 (LTBR)
Cytokine receptors [BR:hsa04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   4055 (LTBR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNFR_c6
Motif
Other DBs
NCBI-GeneID: 4055
NCBI-ProteinID: NP_002333
OMIM: 600979
HGNC: 6718
Ensembl: ENSG00000111321
Vega: OTTHUMG00000168356
Pharos: P36941(Tbio)
UniProt: P36941
LinkDB All DBs
Structure
PDB: 

Position
12p13.31
AA seq 435 aa AA seqDB search
MLLPWATSAPGLAWGPLVLGLFGLLAASQPQAVPPYASENQTCRDQEKEYYEPQHRICCS
RCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKR
KTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSS
PSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMLAVLLPLAFFLLL
ATVFSCIWKSHPSLCRKLGSLLKRRPQGEGPNPVAGSWEPPKAHPYFPDLVQPLLPISGD
VSPVSTGLPAAPVLEAGVPQQQSPLDLTREPQLEPGEQSQVAHGTNGIHVTGGSMTITGN
IYIYNGPVLGGPPGPGDLPATPEPPYPIPEEGDPGPPGLSTPHQEDGKAWHLAETEHCGA
TPSNRGPRNQFITHD
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgctcctgccttgggccacctctgcccccggcctggcctgggggcctctggtgctgggc
ctcttcgggctcctggcagcatcgcagccccaggcggtgcctccatatgcgtcggagaac
cagacctgcagggaccaggaaaaggaatactatgagccccagcaccgcatctgctgctcc
cgctgcccgccaggcacctatgtctcagctaaatgtagccgcatccgggacacagtttgt
gccacatgtgccgagaattcctacaacgagcactggaactacctgaccatctgccagctg
tgccgcccctgtgacccagtgatgggcctcgaggagattgccccctgcacaagcaaacgg
aagacccagtgccgctgccagccgggaatgttctgtgctgcctgggccctcgagtgtaca
cactgcgagctactttctgactgcccgcctggcactgaagccgagctcaaagatgaagtt
gggaagggtaacaaccactgcgtcccctgcaaggccgggcacttccagaatacctcctcc
cccagcgcccgctgccagccccacaccaggtgtgagaaccaaggtctggtggaggcagct
ccaggcactgcccagtccgacacaacctgcaaaaatccattagagccactgcccccagag
atgtcaggaaccatgctgatgctggccgttctgctgccactggccttctttctgctcctt
gccaccgtcttctcctgcatctggaagagccacccttctctctgcaggaaactgggatcg
ctgctcaagaggcgtccgcagggagagggacccaatcctgtagctggaagctgggagcct
ccgaaggcccatccatacttccctgacttggtacagccactgctacccatttctggagat
gtttccccagtatccactgggctccccgcagccccagttttggaggcaggggtgccgcaa
cagcagagtcctctggacctgaccagggagccgcagttggaacccggggagcagagccag
gtggcccacggtaccaatggcattcatgtcaccggcgggtctatgactatcactggcaac
atctacatctacaatggaccagtactggggggaccaccgggtcctggagacctcccagct
acccccgaacctccataccccattcccgaagagggggaccctggccctcccgggctctct
acaccccaccaggaagatggcaaggcttggcacctagcggagacagagcactgtggtgcc
acaccctctaacaggggcccaaggaaccaatttatcacccatgactga

DBGET integrated database retrieval system