KEGG   Homo sapiens (human): 4060Help
Entry
4060              CDS       T01001                                 

Gene name
LUM, LDC, SLRR2D
Definition
(RefSeq) lumican
  KO
K08122  lumican
Organism
hsa  Homo sapiens (human)
Pathway
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    4060 (LUM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00535 Proteoglycans [BR:hsa00535]
    4060 (LUM)
Proteoglycans [BR:hsa00535]
 Extracellular matrix (ECM) proteoglycans
  Small leucine-rich proteoglycan (SLRP) family
   class II
    4060 (LUM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_8 LRR_4 LRR_6 LRR_9 LRRNT LRR_5
Motif
Other DBs
NCBI-GeneID: 4060
NCBI-ProteinID: NP_002336
OMIM: 600616
HGNC: 6724
Ensembl: ENSG00000139329
Vega: OTTHUMG00000170074
Pharos: P51884(Tbio)
UniProt: P51884 A0A384N669
LinkDB All DBs
Position
12q21.33
AA seq 338 aa AA seqDB search
MSLSAFTLFLALIGGTSGQYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKS
VPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKK
LHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAF
KGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNE
LADSGIPGNSFNVSSLVELDLSYNKLKNIPTVNENLENYYLEVNQLEKFDIKSFCKILGP
LSYSKIKHLRLDGNRISETSLPPDMYECLRVANEVTLN
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgagtctaagtgcatttactctcttcctggcattgattggtggtaccagtggccagtac
tatgattatgattttcccctatcaatttatgggcaatcatcaccaaactgtgcaccagaa
tgtaactgccctgaaagctacccaagtgccatgtactgtgatgagctgaaattgaaaagt
gtaccaatggtgcctcctggaatcaagtatctttaccttaggaataaccagattgaccat
attgatgaaaaggcctttgagaatgtaactgatctgcagtggctcattctagatcacaac
cttctagaaaactccaagataaaagggagagttttctctaaattgaaacaactgaagaag
ctgcatataaaccacaacaacctgacagagtctgtgggcccacttcccaaatctctggag
gatctgcagcttactcataacaagatcacaaagctgggctcttttgaaggattggtaaac
ctgaccttcatccatctccagcacaatcggctgaaagaggatgctgtttcagctgctttt
aaaggtcttaaatcactcgaataccttgacttgagcttcaatcagatagccagactgcct
tctggtctccctgtctctcttctaactctctacttagacaacaataagatcagcaacatc
cctgatgagtatttcaagcgttttaatgcattgcagtatctgcgtttatctcacaacgaa
ctggctgatagtggaatacctggaaattctttcaatgtgtcatccctggttgagctggat
ctgtcctataacaagcttaaaaacataccaactgtcaatgaaaaccttgaaaactattac
ctggaggtcaatcaacttgagaagtttgacataaagagcttctgcaagatcctggggcca
ttatcctactccaagatcaagcatttgcgtttggatggcaatcgcatctcagaaaccagt
cttccaccggatatgtatgaatgtctacgtgttgctaacgaagtcactcttaattaa

DBGET integrated database retrieval system