KEGG   Homo sapiens (human): 4070
Entry
4070              CDS       T01001                                 

Gene name
TACSTD2, EGP-1, EGP1, GA733-1, GA7331, GP50, M1S1, TROP2
Definition
(RefSeq) tumor associated calcium signal transducer 2
  KO
K17288  tumor-associated calcium signal transducer 2
Organism
hsa  Homo sapiens (human)
Disease
H00953  Gelatinous drop-like corneal dystrophy
Drug target
Sacituzumab govitecan: D10985
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    4070 (TACSTD2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   4070 (TACSTD2)
SSDB
Motif
Pfam: Thyroglobulin_1 DUF2749 DAG1
Other DBs
NCBI-GeneID: 4070
NCBI-ProteinID: NP_002344
OMIM: 137290
HGNC: 11530
Ensembl: ENSG00000184292
Vega: OTTHUMG00000010067
Pharos: P09758(Tbio)
UniProt: P09758
LinkDB
Structure
PDB: 
2MVK 2MVL 2MAE

Position
1p32.1
AA seq 323 aa
MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGS
GMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCN
QTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLF
RERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRG
GLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNR
RKSGKYKKVEIKELGELRKEPSL
NT seq 972 nt   +upstreamnt  +downstreamnt
atggctcggggccccggcctcgcgccgccaccgctgcggctgccgctgctgctgctggtg
ctggcggcggtgaccggccacacggccgcgcaggacaactgcacgtgtcccaccaacaag
atgaccgtgtgcagccccgacggccccggcggccgctgccagtgccgcgcgctgggctcg
ggcatggcggtcgactgctccacgctgacctccaagtgtctgctgctcaaggcgcgcatg
agcgcccccaagaacgcccgcacgctggtgcggccgagtgagcacgcgctcgtggacaac
gatggcctctacgaccccgactgcgaccccgagggccgcttcaaggcgcgccagtgcaac
cagacgtcggtgtgctggtgcgtgaactcggtgggcgtgcgccgcacggacaagggcgac
ctgagcctacgctgcgatgagctggtgcgcacccaccacatcctcattgacctgcgccac
cgccccaccgccggcgccttcaaccactcagacctggacgccgagctgaggcggctcttc
cgcgagcgctatcggctgcaccccaagttcgtggcggccgtgcactacgagcagcccacc
atccagatcgagctgcggcagaacacgtctcagaaggccgccggtgacgtggatatcggc
gatgccgcctactacttcgagagggacatcaagggcgagtctctattccagggccgcggc
ggcctggacttgcgcgtgcgcggagaacccctgcaggtggagcgcacgctcatctattac
ctggacgagattcccccgaagttctccatgaagcgcctcaccgccggcctcatcgccgtc
atcgtggtggtcgtggtggccctcgtcgccggcatggccgtcctggtgatcaccaaccgg
agaaagtcggggaagtacaagaaggtggagatcaaggaactgggggagttgagaaaggaa
ccgagcttgtag

DBGET integrated database retrieval system