KEGG   Homo sapiens (human): 4082
Entry
4082              CDS       T01001                                 

Gene name
MARCKS, 80K-L, MACS, PKCSL, PRKCSL
Definition
(RefSeq) myristoylated alanine rich protein kinase C substrate
  KO
K12561  myristoylated alanine-rich C-kinase substrate
Organism
hsa  Homo sapiens (human)
Pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    4082 (MARCKS)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    4082 (MARCKS)
SSDB
Motif
Pfam: MARCKS
Other DBs
NCBI-GeneID: 4082
NCBI-ProteinID: NP_002347
OMIM: 177061
HGNC: 6759
Ensembl: ENSG00000277443
Vega: OTTHUMG00000188327
Pharos: P29966(Tbio)
UniProt: P29966 Q6NVI1
LinkDB
Position
6q21
AA seq 332 aa
MGAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAESGAKEELQA
NGSAPAADKEEPAAAGSGAASPSAAEKGEPAAAAAPEAGASPVEKEAPAEGEAAEPGSPT
AAEGEAASAASSTSSPKAEDGATPSPSNETPKKKKKRFSFKKSFKLSGFSFKKNKKEAGE
GGEAEAPAAEGGKDEAAGGAAAAAAEAGAASGEQAAAPGEEAAAGEEGAAGGDPQEAKPQ
EAAVAPEKPPASDETKAAEEPSKVEEKKAEEAGASAAACEAPSAAGPGAPPEQEAAPAEE
PAAAAASSACAAPSQEAQPECSPEAPPAEAAE
NT seq 999 nt   +upstreamnt  +downstreamnt
atgggtgcccagttctccaagaccgcagcgaagggagaagccgccgcggagaggcctggg
gaggcggctgtggcctcgtcgccttccaaagcgaacggacaggagaatggccacgtgaag
gtaaacggcgacgcttcgcccgcggccgccgagtcgggcgccaaggaggagctgcaggcc
aacggcagcgccccggccgccgacaaggaggagcccgcggccgccgggagcggggcggcg
tcgccctccgcggccgagaaaggtgagccggccgccgccgctgcccccgaggccggggcc
agcccggtagagaaggaggcccccgcggaaggcgaggctgccgagcccggctcgcccacg
gccgcggagggagaggccgcgtcggccgcctcctcgacttcttcgcccaaggccgaggac
ggggccacgccctcgcccagcaacgagaccccgaaaaaaaaaaagaagcgcttttccttc
aagaagtctttcaagctgagcggcttctccttcaagaagaacaagaaggaggctggagaa
ggcggtgaggctgaggcgcccgctgccgaaggcggcaaggacgaggccgccgggggcgca
gctgcggccgccgccgaggcgggcgcggcctccggggagcaggcagcggcgccgggcgag
gaggcggcagcgggcgaggagggggcggcgggtggcgacccgcaggaggccaagccccag
gaggccgctgtcgcgccagagaagccgcccgccagcgacgagaccaaggccgccgaggag
cccagcaaggtggaggagaaaaaggccgaggaggccggggccagcgccgccgcctgcgag
gccccctccgccgccgggcccggcgcgcccccggagcaggaggcagcccccgcggaggag
cccgcggccgccgcagcctcgtcagcctgcgcagccccctcacaggaggcccagcccgag
tgcagtccagaagcccccccagcggaggcggcagagtaa

KEGG   Homo sapiens (human): 65108
Entry
65108             CDS       T01001                                 

Gene name
MARCKSL1, F52, MACMARCKS, MLP, MLP1, MRP
Definition
(RefSeq) MARCKS like 1
  KO
K13536  MARCKS-related protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa05140  Leishmaniasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    65108 (MARCKSL1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    65108 (MARCKSL1)
SSDB
Motif
Pfam: MARCKS
Other DBs
NCBI-GeneID: 65108
NCBI-ProteinID: NP_075385
OMIM: 602940
HGNC: 7142
Ensembl: ENSG00000175130
Vega: OTTHUMG00000007589
Pharos: P49006(Tbio)
UniProt: P49006
LinkDB
Position
1p35.1
AA seq 195 aa
MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGA
TGDAIEPAPPSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASS
PTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPS
GPESGPTPASAEQNE
NT seq 588 nt   +upstreamnt  +downstreamnt
atgggcagccagagctccaaggctccccggggcgacgtgaccgccgaggaggcagcaggc
gcttcccccgcgaaggccaacggccaggagaatggccacgtgaaaagcaatggagactta
tcccccaagggtgaaggggagtcgccccctgtgaacggaacagatgaggcagccggggcc
actggcgatgccatcgagccagcaccccctagccagggtgctgaggccaagggggaggtc
ccccccaaggagacccccaagaagaagaagaaattctctttcaagaagcctttcaaattg
agcggcctgtccttcaagagaaatcggaaggagggtgggggtgattcttctgcctcctca
cccacagaggaagagcaggagcagggggagatcggtgcctgcagcgacgagggcactgct
caggaagggaaggccgcagccacccctgagagccaggaaccccaggccaagggggcagag
gctagtgcagcctcagaagaagaggcagggccccaggctacagagccatccactccctcg
gggccggagagtggccctacaccagccagcgctgagcagaatgagtag

DBGET integrated database retrieval system