KEGG   Homo sapiens (human): 4085Help
Entry
4085              CDS       T01001                                 

Gene name
MAD2L1, HSMAD2, MAD2
Definition
(RefSeq) mitotic arrest deficient 2 like 1
  KO
K02537  mitotic spindle assembly checkpoint protein MAD2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    4085 (MAD2L1)
   04114 Oocyte meiosis
    4085 (MAD2L1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    4085 (MAD2L1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4085 (MAD2L1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    4085 (MAD2L1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     4085 (MAD2L1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HORMA ATG101 ATG13 bacHORMA_2
Motif
Other DBs
NCBI-GeneID: 4085
NCBI-ProteinID: NP_002349
OMIM: 601467
HGNC: 6763
Ensembl: ENSG00000164109
Vega: OTTHUMG00000132967
Pharos: Q13257(Tbio)
UniProt: Q13257
LinkDB All DBs
Structure
PDB: 

Position
4q27
AA seq 205 aa AA seqDB search
MALQLSREQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDLE
LIKYLNNVVEQLKDWLYKCSVQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKS
QKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEE
VRLRSFTTTIHKVNSMVAYKIPVND
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcagctctcccgggagcagggaatcaccctgcgcgggagcgccgaaatcgtg
gccgagttcttctcattcggcatcaacagcattttatatcagcgtggcatatatccatct
gaaacctttactcgagtgcagaaatacggactcaccttgcttgtaactactgatcttgag
ctcataaaatacctaaataatgtggtggaacaactgaaagattggttatacaagtgttca
gttcagaaactggttgtagttatctcaaatattgaaagtggtgaggtcctggaaagatgg
cagtttgatattgagtgtgacaagactgcaaaagatgacagtgcacccagagaaaagtct
cagaaagctatccaggatgaaatccgttcagtgatcagacagatcacagctacggtgaca
tttctgccactgttggaagtttcttgttcatttgatctgctgatttatacagacaaagat
ttggttgtacctgaaaaatgggaagagtcgggaccacagtttattaccaattctgaggaa
gtccgccttcgttcatttactactacaatccacaaagtaaatagcatggtggcctacaaa
attcctgtcaatgactga

KEGG   Homo sapiens (human): 10459Help
Entry
10459             CDS       T01001                                 

Gene name
MAD2L2, FANCV, MAD2B, POLZ2, REV7
Definition
(RefSeq) mitotic arrest deficient 2 like 2
  KO
K13728  mitotic spindle assembly checkpoint protein MAD2B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04914  Progesterone-mediated oocyte maturation
hsa05100  Bacterial invasion of epithelial cells
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Disease
H00238  Fanconi anemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    10459 (MAD2L2)
   04114 Oocyte meiosis
    10459 (MAD2L2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    10459 (MAD2L2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    10459 (MAD2L2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    10459 (MAD2L2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     10459 (MAD2L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HORMA
Motif
Other DBs
NCBI-GeneID: 10459
NCBI-ProteinID: NP_001120797
OMIM: 604094
HGNC: 6764
Ensembl: ENSG00000116670
Vega: OTTHUMG00000002231
Pharos: Q9UI95(Tbio)
UniProt: Q9UI95 A0A024R4I4
LinkDB All DBs
Structure
PDB: 

Position
1p36.22
AA seq 211 aa AA seqDB search
MTTLTRQDLNFGQVVADVLCEFLEVAVHLILYVREVYPVGIFQKRKKYNVPVQMSCHPEL
NQYIQDTLHCVKPLLEKNDVEKVVVVILDKEHRPVEKFVFEITQPPLLSISSDSLLSHVE
QLLRAFILKISVCDAVLDHNPPGCTFTVLVHTREAATRNMEKIQVIKDFPWILADEQDVH
MHDPRLIPLKTMTSDILKMQLYVEERAHKGS
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgaccacgctcacacgacaagacctcaactttggccaagtggtggccgatgtgctctgc
gagttcctggaggtggctgtgcatctcatcctctacgtgcgcgaggtctaccccgtgggc
atcttccagaaacgcaagaagtacaacgtgccggtccagatgtcctgccacccggagctg
aatcagtatatccaggacacgctgcactgcgtcaagccactcctggagaagaatgatgtg
gagaaagtggtggtggtgattttggataaagagcaccgcccagtggagaaattcgtcttt
gagatcacccagcctccactgctgtccatcagctcagactcgctgttgtctcatgtggag
cagctgctccgggccttcatcctgaagatcagcgtgtgcgatgccgtcctggaccacaac
cccccaggctgtaccttcacagtcctggtgcacacgagagaagccgccactcgcaacatg
gagaagatccaggtcatcaaggatttcccctggatcctggcggatgagcaggatgtccac
atgcatgacccccggctgataccactaaaaaccatgacgtcggacattttaaagatgcag
ctttacgtggaagagcgcgctcataaaggcagctga

KEGG   Homo sapiens (human): 701Help
Entry
701               CDS       T01001                                 

Gene name
BUB1B, BUB1beta, BUBR1, Bub1A, MAD3L, MVA1, SSK1, hBUBR1
Definition
(RefSeq) BUB1 mitotic checkpoint serine/threonine kinase B
  KO
K06637  mitotic checkpoint serine/threonine-protein kinase BUB1 beta [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Disease
H01288  Mosaic variegated aneuploidy syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    701 (BUB1B)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    701 (BUB1B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    701 (BUB1B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    701 (BUB1B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     701 (BUB1B)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  BUB family
   701 (BUB1B)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     701 (BUB1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mad3_BUB1_I Pkinase Pkinase_Tyr Mad3_BUB1_II Mad3_BUB1_I_2
Motif
Other DBs
NCBI-GeneID: 701
NCBI-ProteinID: NP_001202
OMIM: 602860
HGNC: 1149
Ensembl: ENSG00000156970
Vega: OTTHUMG00000129877
Pharos: O60566(Tbio)
UniProt: O60566
LinkDB All DBs
Structure
PDB: 

Position
15q15.1
AA seq 1050 aa AA seqDB search
MAAVKKEGGALSEAMSLEGDEWELSKENVQPLRQGRIMSTLQGALAQESACNNTLQQQKR
AFEYEIRFYTGNDPLDVWDRYISWTEQNYPQGGKESNMSTLLERAVEALQGEKRYYSDPR
FLNLWLKLGRLCNEPLDMYSYLHNQGIGVSLAQFYISWAEEYEARENFRKADAIFQEGIQ
QKAEPLERLQSQHRQFQARVSRQTLLALEKEEEEEVFESSVPQRSTLAELKSKGKKTARA
PIIRVGGALKAPSQNRGLQNPFPQQMQNNSRITVFDENADEASTAELSKPTVQPWIAPPM
PRAKENELQAGPWNTGRSLEHRPRGNTASLIAVPAVLPSFTPYVEETARQPVMTPCKIEP
SINHILSTRKPGKEEGDPLQRVQSHQQASEEKKEKMMYCKEKIYAGVGEFSFEEIRAEVF
RKKLKEQREAELLTSAEKRAEMQKQIEEMEKKLKEIQTTQQERTGDQQEETMPTKETTKL
QIASESQKIPGMTLSSSVCQVNCCARETSLAENIWQEQPHSKGPSVPFSIFDEFLLSEKK
NKSPPADPPRVLAQRRPLAVLKTSESITSNEDVSPDVCDEFTGIEPLSEDAIITGFRNVT
ICPNPEDTCDFARAARFVSTPFHEIMSLKDLPSDPERLLPEEDLDVKTSEDQQTACGTIY
SQTLSIKKLSPIIEDSREATHSSGFSGSSASVASTSSIKCLQIPEKLELTNETSENPTQS
PWCSQYRRQLLKSLPELSASAELCIEDRPMPKLEIEKEIELGNEDYCIKREYLICEDYKL
FWVAPRNSAELTVIKVSSQPVPWDFYINLKLKERLNEDFDHFCSCYQYQDGCIVWHQYIN
CFTLQDLLQHSEYITHEITVLIIYNLLTIVEMLHKAEIVHGDLSPRCLILRNRIHDPYDC
NKNNQALKIVDFSYSVDLRVQLDVFTLSGFRTVQILEGQKILANCSSPYQVDLFGIADLA
HLLLFKEHLQVFWDGSFWKLSQNISELKDGELWNKFFVRILNANDEATVSVLGELAAEMN
GVFDTTFQSHLNKALWKVGKLTSPGALLFQ
NT seq 3153 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtgaagaaggaagggggtgctctgagtgaagccatgtccctggagggagat
gaatgggaactgagtaaagaaaatgtacaacctttaaggcaagggcggatcatgtccacg
cttcagggagcactggcacaagaatctgcctgtaacaatactcttcagcagcagaaacgg
gcatttgaatatgaaattcgattttacactggaaatgaccctctggatgtttgggatagg
tatatcagctggacagagcagaactatcctcaaggtgggaaggagagtaatatgtcaacg
ttattagaaagagctgtagaagcactacaaggagaaaaacgatattatagtgatcctcga
tttctcaatctctggcttaaattagggcgtttatgcaatgagcctttggatatgtacagt
tacttgcacaaccaagggattggtgtttcacttgctcagttctatatctcatgggcagaa
gaatatgaagctagagaaaactttaggaaagcagatgcgatatttcaggaagggattcaa
cagaaggctgaaccactagaaagactacagtcccagcaccgacaattccaagctcgagtg
tctcggcaaactctgttggcacttgagaaagaagaagaggaggaagtttttgagtcttct
gtaccacaacgaagcacactagctgaactaaagagcaaagggaaaaagacagcaagagct
ccaatcatccgtgtaggaggtgctctcaaggctccaagccagaacagaggactccaaaat
ccatttcctcaacagatgcaaaataatagtagaattactgtttttgatgaaaatgctgat
gaggcttctacagcagagttgtctaagcctacagtccagccatggatagcaccccccatg
cccagggccaaagagaatgagctgcaagcaggcccttggaacacaggcaggtccttggaa
cacaggcctcgtggcaatacagcttcactgatagctgtacccgctgtgcttcccagtttc
actccatatgtggaagagactgcacgacagccagttatgacaccatgtaaaattgaacct
agtataaaccacatcctaagcaccagaaagcctggaaaggaagaaggagatcctctacaa
agggttcagagccatcagcaagcgtctgaggagaagaaagagaagatgatgtattgtaag
gagaagatttatgcaggagtaggggaattctcctttgaagaaattcgggctgaagttttc
cggaagaaattaaaagagcaaagggaagccgagctattgaccagtgcagagaagagagca
gaaatgcagaaacagattgaagagatggagaagaagctaaaagaaatccaaactactcag
caagaaagaacaggtgatcagcaagaagagacgatgcctacaaaggagacaactaaactg
caaattgcttccgagtctcagaaaataccaggaatgactctatccagttctgtttgtcaa
gtaaactgttgtgccagagaaacttcacttgcggagaacatttggcaggaacaacctcat
tctaaaggtcccagtgtacctttctccatttttgatgagtttcttctttcagaaaagaag
aataaaagtcctcctgcagatcccccacgagttttagctcaacgaagaccccttgcagtt
ctcaaaacctcagaaagcatcacctcaaatgaagatgtgtctccagatgtttgtgatgaa
tttacaggaattgaacccttgagcgaggatgccattatcacaggcttcagaaatgtaaca
atttgtcctaacccagaagacacttgtgactttgccagagcagctcgttttgtatccact
ccttttcatgagataatgtccttgaaggatctcccttctgatcctgagagactgttaccg
gaagaagatctagatgtaaagacctctgaggaccagcagacagcttgtggcactatctac
agtcagactctcagcatcaagaagctgagcccaattattgaagacagtcgtgaagccaca
cactcctctggcttctctggttcttctgcctcggttgcaagcacctcctccatcaaatgt
cttcaaattcctgagaaactagaacttactaatgagacttcagaaaaccctactcagtca
ccatggtgttcacagtatcgcagacagctactgaagtccctaccagagttaagtgcctct
gcagagttgtgtatagaagacagaccaatgcctaagttggaaattgagaaggaaattgaa
ttaggtaatgaggattactgcattaaacgagaatacctaatatgtgaagattacaagtta
ttctgggtggcgccaagaaactctgcagaattaacagtaataaaggtatcttctcaacct
gtcccatgggacttttatatcaacctcaagttaaaggaacgtttaaatgaagattttgat
catttttgcagctgttatcaatatcaagatggctgtattgtttggcaccaatatataaac
tgcttcacccttcaggatcttctccaacacagtgaatatattacccatgaaataacagtg
ttgattatttataaccttttgacaatagtggagatgctacacaaagcagaaatagtccat
ggtgacttgagtccaaggtgtctgattctcagaaacagaatccacgatccctatgattgt
aacaagaacaatcaagctttgaagatagtggacttttcctacagtgttgaccttagggtg
cagctggatgtttttaccctcagcggctttcggactgtacagatcctggaaggacaaaag
atcctggctaactgttcttctccctaccaggtagacctgtttggtatagcagatttagca
catttactattgttcaaggaacacctacaggtcttctgggatgggtccttctggaaactt
agccaaaatatttctgagctaaaagatggtgaattgtggaataaattctttgtgcggatt
ctgaatgccaatgatgaggccacagtgtctgttcttggggagcttgcagcagaaatgaat
ggggtttttgacactacattccaaagtcacctgaacaaagccttatggaaggtagggaag
ttaactagtcctggggctttgctctttcagtga

KEGG   Homo sapiens (human): 9184Help
Entry
9184              CDS       T01001                                 

Gene name
BUB3, BUB3L, hBUB3
Definition
(RefSeq) BUB3 mitotic checkpoint protein
  KO
K02180  cell cycle arrest protein BUB3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06130  Cell cycle (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06230  Cell cycle G1/S
  Element
N00222  HTLV-1 Tax to spindle assembly checkpoint signaling
N00493  Spindle assembly checkpoint signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    9184 (BUB3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    9184 (BUB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    9184 (BUB3)
   03036 Chromosome and associated proteins [BR:hsa03036]
    9184 (BUB3)
Spliceosome [BR:hsa03041]
 Complex A
  Other components
   Complex A specific factors
    9184 (BUB3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Core SAC proteins
     9184 (BUB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40
Motif
Other DBs
NCBI-GeneID: 9184
NCBI-ProteinID: NP_004716
OMIM: 603719
HGNC: 1151
Ensembl: ENSG00000154473
Vega: OTTHUMG00000019197
Pharos: O43684(Tbio)
UniProt: O43684
LinkDB All DBs
Position
10q26.13
AA seq 328 aa AA seqDB search
MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMRLKYQHTGAVL
DCAFYDPTHAWSGGLDHQLKMHDLNTDQENLVGTHDAPIRCVEYCPEVNVMVTGSWDQTV
KLWDPRTPCNAGTFSQPEKVYTLSVSGDRLIVGTAGRRVLVWDLRNMGYVQQRRESSLKY
QTRCIRAFPNKQGYVLSSIEGRVAVEYLDPSPEVQKKKYAFKCHRLKENNIEQIYPVNAI
SFHNIHNTFATGGSDGFVNIWDPFNKKRLCQFHRYPTSIASLAFSNDGTTLAIASSYMYE
MDDTEHPEDGIFIRQVTDAETKPKSPCT
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgaccggttctaacgagttcaagctgaaccagccacccgaggatggcatctcctccgtg
aagttcagccccaacacctcccagttcctgcttgtctcctcctgggacacgtccgtgcgt
ctctacgatgtgccggccaactccatgcggctcaagtaccagcacaccggcgccgtcctg
gactgcgccttctacgatccaacgcatgcctggagtggaggactagatcatcaattgaaa
atgcatgatttgaacactgatcaagaaaatcttgttgggacccatgatgcccctatcaga
tgtgttgaatactgtccagaagtgaatgtgatggtcactggaagttgggatcagacagtt
aaactgtgggatcccagaactccttgtaatgctgggaccttctctcagcctgaaaaggta
tataccctctcagtgtctggagaccggctgattgtgggaacagcaggccgcagagtgttg
gtgtgggacttacggaacatgggttacgtgcagcagcgcagggagtccagcctgaaatac
cagactcgctgcatacgagcgtttccaaacaagcagggttatgtattaagctctattgaa
ggccgagtggcagttgagtatttggacccaagccctgaggtacagaagaagaagtatgcc
ttcaaatgtcacagactaaaagaaaataatattgagcagatttacccagtcaatgccatt
tcttttcacaatatccacaatacatttgccacaggtggttctgatggctttgtaaatatt
tgggatccatttaacaaaaagcgactgtgccaattccatcggtaccccacgagcatcgca
tcacttgccttcagtaatgatgggactacgcttgcaatagcgtcatcatatatgtatgaa
atggatgacacagaacatcctgaagatggtatcttcattcgccaagtgacagatgcagaa
acaaaacccaagtcaccatgtacttga

DBGET integrated database retrieval system