KEGG   Homo sapiens (human): 4093
Entry
4093              CDS       T01001                                 

Gene name
SMAD9, MADH6, MADH9, PPH2, SMAD8, SMAD8/9, SMAD8A, SMAD8B
Definition
(RefSeq) SMAD family member 9
  KO
K16791  mothers against decapentaplegic homolog 9
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
Disease
H01621  Pulmonary arterial hypertension
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    4093 (SMAD9)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    4093 (SMAD9)
SSDB
Motif
Pfam: MH2 MH1 IRF-3 DUF4223
Other DBs
NCBI-GeneID: 4093
NCBI-ProteinID: NP_001120689
OMIM: 603295
HGNC: 6774
Ensembl: ENSG00000120693
Vega: OTTHUMG00000016740
Pharos: O15198(Tbio)
UniProt: O15198
LinkDB
Structure
PDB: 
6FZT

Position
13q13.3
AA seq 467 aa
MHSTTPISSLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDSLVKKLKKKKGAMDELERALS
CPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLECCEFPFGSK
QKEVCINPYHYRRVETPVLPPVLVPRHSEYNPQLSLLAKFRSASLHSEPLMPHNATYPDS
FQQPPCSALPPSPSHAFSQSPCTASYPHSPGSPSEPESPYQHSVDTPPLPYHATEASETQ
SGQPVDATADRHVVLSIPNGDFRPVCYEEPQHWCSVAYYELNNRVGETFQASSRSVLIDG
FTDPSNNRNRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECVSDSSIFVQSR
NCNYQHGFHPATVCKIPSGCSLKVFNNQLFAQLLAQSVHHGFEVVYELTKMCTIRMSFVK
GWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPHNPISSVS
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgcactccaccacccccatcagctccctcttctccttcaccagccccgcagtgaagaga
ctgctaggctggaagcaaggagatgaagaggaaaagtgggcagagaaggcagtggactct
ctagtgaagaagttaaagaagaagaagggagccatggacgagctggagagggctctcagc
tgcccggggcagcccagcaaatgcgtcacgattccccgctccctggacgggcggctgcag
gtgtcccaccgcaagggcctgccccatgtgatttactgtcgcgtgtggcgctggccggat
ctgcagtcccaccacgagctgaagccgctggagtgctgtgagttcccatttggctccaag
cagaaagaagtgtgcattaacccttaccactaccgccgggtggagactccagtactgcct
cctgtgctcgtgccaagacacagtgaatataacccccagctcagcctcctggccaagttc
cgcagcgcctccctgcacagtgagccactcatgccacacaacgccacctatcctgactct
ttccagcagcctccgtgctctgcactccctccctcacccagccacgcgttctcccagtcc
ccgtgcacggccagctaccctcactccccaggaagtccttctgagccagagagtccctat
caacactcagttgacacaccacccctgccttatcatgccacagaagcctctgagacccag
agtggccaacctgtagatgccacagctgatagacatgtagtgctatcgataccaaatgga
gactttcgaccagtttgttacgaggagccccagcactggtgctcggtcgcctactatgaa
ctgaacaaccgagttggggagacattccaggcttcctcccgaagtgtgctcatagatggg
ttcaccgacccttcaaataacaggaacagattctgtcttggacttctttctaatgtaaac
agaaactcaacgatagaaaataccaggagacatataggaaagggtgtgcacttgtactac
gtcgggggagaggtgtatgccgagtgcgtgagtgacagcagcatctttgtgcagagccgg
aactgcaactatcaacacggcttccacccagctaccgtctgcaagatccccagcggctgc
agcctcaaggtcttcaacaaccagctcttcgctcagctcctggcccagtcagttcaccac
ggctttgaagtcgtgtatgaactgaccaagatgtgtactatccggatgagttttgttaag
ggttggggtgctgagtatcatcgccaggatgtcaccagcaccccctgctggattgagatt
catcttcatgggccactgcagtggctggacaaagttctgactcagatgggctctccacat
aaccccatttcttcagtgtcttaa

DBGET integrated database retrieval system