KEGG   Homo sapiens (human): 410Help
Entry
410               CDS       T01001                                 

Gene name
ARSA, ASA, MLD
Definition
(RefSeq) arylsulfatase A
  KO
K01134  arylsulfatase A [EC:3.1.6.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00600  Sphingolipid metabolism
hsa04142  Lysosome
Network
nt06014  Sphingolipid degradation
  Element
N00647  Hydrolysis of galactosylceramide sulfate
N00648  ARSA deficiency in galactosylceramide sulfate hydrolysis
Disease
H00127  Metachromatic leukodystrophy
H00423  Sphingolipidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    410 (ARSA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    410 (ARSA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.8  cerebroside-sulfatase
     410 (ARSA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfatase Sulfatase_C Phosphodiest DUF1501
Motif
Other DBs
NCBI-GeneID: 410
NCBI-ProteinID: NP_000478
OMIM: 607574
HGNC: 713
Ensembl: ENSG00000100299
Vega: OTTHUMG00000150180
Pharos: P15289(Tbio)
UniProt: P15289 A0A0C4DFZ2 B4DVI5
LinkDB All DBs
Structure
PDB: 

Position
22q13.33
AA seq 509 aa AA seqDB search
MSMGAPRSLLLALAAGLAVARPPNIVLIFADDLGYGDLGCYGHPSSTTPNLDQLAAGGLR
FTDFYVPVSLCTPSRAALLTGRLPVRMGMYPGVLVPSSRGGLPLEEVTVAEVLAARGYLT
GMAGKWHLGVGPEGAFLPPHQGFHRFLGIPYSHDQGPCQNLTCFPPATPCDGGCDQGLVP
IPLLANLSVEAQPPWLPGLEARYMAFAHDLMADAQRQDRPFFLYYASHHTHYPQFSGQSF
AERSGRGPFGDSLMELDAAVGTLMTAIGDLGLLEETLVIFTADNGPETMRMSRGGCSGLL
RCGKGTTYEGGVREPALAFWPGHIAPGVTHELASSLDLLPTLAALAGAPLPNVTLDGFDL
SPLLLGTGKSPRQSLFFYPSYPDEVRGVFAVRTGKYKAHFFTQGSAHSDTTADPACHASS
SLTAHEPPLLYDLSKDPGENYNLLGGVAGATPEVLQALKQLQLLKAQLDAAVTFGPSQVA
RGEDPALQICCHPGCTPRPACCHCPDPHA
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgggggcaccgcggtccctcctcctggccctggctgctggcctggccgttgcc
cgtccgcccaacatcgtgctgatctttgccgacgacctcggctatggggacctgggctgc
tatgggcaccccagctctaccactcccaacctggaccagctggcggcgggagggctgcgg
ttcacagacttctacgtgcctgtgtctctgtgcacaccctctagggccgccctcctgacc
ggccggctcccggttcggatgggcatgtaccctggcgtcctggtgcccagctcccggggg
ggcctgcccctggaggaggtgaccgtggccgaagtcctggctgcccgaggctacctcaca
ggaatggccggcaagtggcaccttggggtggggcctgagggggccttcctgcccccccat
cagggcttccatcgatttctaggcatcccgtactcccacgaccagggcccctgccagaac
ctgacctgcttcccgccggccactccttgcgacggtggctgtgaccagggcctggtcccc
atcccactgttggccaacctgtccgtggaggcgcagcccccctggctgcccggactagag
gcccgctacatggctttcgcccatgacctcatggccgacgcccagcgccaggatcgcccc
ttcttcctgtactatgcctctcaccacacccactaccctcagttcagtgggcagagcttt
gcagagcgttcaggccgcgggccatttggggactccctgatggagctggatgcagctgtg
gggaccctgatgacagccataggggacctggggctgcttgaagagacgctggtcatcttc
actgcagacaatggacctgagaccatgcgtatgtcccgaggcggctgctccggtctcttg
cggtgtggaaagggaacgacctacgagggcggtgtccgagagcctgccttggccttctgg
ccaggtcatatcgctcccggcgtgacccacgagctggccagctccctggacctgctgcct
accctggcagccctggctggggccccactgcccaatgtcaccttggatggctttgacctc
agccccctgctgctgggcacaggcaagagccctcggcagtctctcttcttctacccgtcc
tacccagacgaggtccgtggggtttttgctgtgcggactggaaagtacaaggctcacttc
ttcacccagggctctgcccacagtgataccactgcagaccctgcctgccacgcctccagc
tctctgactgctcatgagcccccgctgctctatgacctgtccaaggaccctggtgagaac
tacaacctgctggggggtgtggccggggccaccccagaggtgctgcaagccctgaaacag
cttcagctgctcaaggcccagttagacgcagctgtgaccttcggccccagccaggtggcc
cggggcgaggaccccgccctgcagatctgctgtcatcctggctgcaccccccgcccagct
tgctgccattgcccagatccccatgcctga

DBGET integrated database retrieval system