KEGG   Homo sapiens (human): 411
Entry
411               CDS       T01001                                 

Gene name
ARSB, ASB, G4S, MPS6
Definition
(RefSeq) arylsulfatase B
  KO
K01135  arylsulfatase B [EC:3.1.6.12]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00531  Glycosaminoglycan degradation
hsa01100  Metabolic pathways
hsa04142  Lysosome
Module
hsa_M00076  Dermatan sulfate degradation
hsa_M00077  Chondroitin sulfate degradation
Network
nt06012  Glycosaminoglycan degradation
  Element
N00610  Dermatan sulfate degradation
N00611  HYAL1 deficiency in dermatan sulfate degradation
N00612  ARSB deficiency in dermatan sulfate degradation
N10014  Replacement of deficient ARSB
Disease
H00131  Mucopolysaccharidosis type VI
H00421  Mucopolysaccharidosis
Drug target
Galsulfase: D06565<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    411 (ARSB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    411 (ARSB)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.6  Sulfuric-ester hydrolases
    3.1.6.12  N-acetylgalactosamine-4-sulfatase
     411 (ARSB)
SSDB
Motif
Pfam: Sulfatase Phosphodiest Sulfatase_C
Other DBs
NCBI-GeneID: 411
NCBI-ProteinID: NP_000037
OMIM: 611542
HGNC: 714
Ensembl: ENSG00000113273
Vega: OTTHUMG00000108129
Pharos: P15848(Tbio)
UniProt: P15848 A0A024RAJ9
LinkDB
Structure
PDB: 
1FSU

Position
5q14.1
AA seq 533 aa
MGPRGAASLPRGPGPRRLLLPVVLPLLLLLLLAPPGSGAGASRPPHLVFLLADDLGWNDV
GFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPS
CVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHER
CTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQS
VHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTD
NGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKL
ARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLP
EYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRD
PEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgggtccgcgcggcgcggcgagcttgccccgaggccccggacctcggcggctgctcctc
cccgtcgtcctcccgctgctgctgctgctgttgttggcgccgccgggctcgggcgccggg
gccagccggccgccccacctggtcttcttgctggcagacgacctaggctggaacgacgtc
ggcttccacggctcccgcatccgcacgccgcacctggacgcgctggcggccggcggggtg
ctcctggacaactactacacgcagccgctgtgcacgccgtcgcggagccagctgctcact
ggccgctaccagatccgtacaggtttacagcaccaaataatctggccctgtcagcccagc
tgtgttcctctggatgaaaaactcctgccccagctcctaaaagaagcaggttatactacc
catatggtcggaaaatggcacctgggaatgtaccggaaagaatgccttccaacccgccga
ggatttgatacctactttggatatctcctgggtagtgaagattattattcccatgaacgc
tgtacattaattgacgctctgaatgtcacacgatgtgctcttgattttcgagatggcgaa
gaagttgcaacaggatataaaaatatgtattcaacaaacatattcaccaaaagggctata
gccctcataactaaccatccaccagagaagcctctgtttctctaccttgctctccagtct
gtgcatgagccccttcaggtccctgaggaatacttgaagccatatgactttatccaagac
aagaacaggcatcactatgcaggaatggtgtcccttatggatgaagcagtaggaaatgtc
actgcagctttaaaaagcagtgggctctggaacaacacggtgttcatcttttctacagat
aacggagggcagactttggcagggggtaataactggccccttcgaggaagaaaatggagc
ctgtgggaaggaggcgtccgaggggtgggctttgtggcaagccccttgctgaagcagaag
ggcgtgaagaaccgggagctcatccacatctctgactggctgccaacactcgtgaagctg
gccaggggacacaccaatggcacaaagcctctggatggcttcgacgtgtggaaaaccatc
agtgaaggaagcccatcccccagaattgagctgctgcataatattgacccgaacttcgtg
gactcttcaccgtgtcccaggaacagcatggctccagcaaaggatgactcttctcttcca
gaatattcagcctttaacacatctgtccatgctgcaattagacatggaaattggaaactc
ctcacgggctacccaggctgtggttactggttccctccaccgtctcaatacaatgtttct
gagataccctcatcagacccaccaaccaagaccctctggctctttgatattgatcgggac
cctgaagaaagacatgacctgtccagagaatatcctcacatcgtcacaaagctcctgtcc
cgcctacagttctaccataaacactcagtccccgtgtacttccctgcacaggacccccgc
tgtgatcccaaggccactggggtgtggggcccttggatgtag

DBGET integrated database retrieval system