KEGG   Homo sapiens (human): 4153Help
Entry
4153              CDS       T01001                                 

Gene name
MBL2, COLEC1, HSMBPC, MBL, MBL2D, MBP, MBP-C, MBP1, MBPD
Definition
(RefSeq) mannose binding lectin 2
  KO
K03991  mannose-binding lectin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04610  Complement and coagulation cascades
hsa05150  Staphylococcus aureus infection
Disease
H00105  Mannose-binding lectin pathway component defects
H00342  Tuberculosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    4153 (MBL2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    4153 (MBL2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    4153 (MBL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4153 (MBL2)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    4153 (MBL2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    4153 (MBL2)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 3: Collectins
   4153 (MBL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C Collagen Thioredoxin_14
Motif
Other DBs
NCBI-GeneID: 4153
NCBI-ProteinID: NP_000233
OMIM: 154545
HGNC: 6922
Ensembl: ENSG00000165471
Vega: OTTHUMG00000150270
Pharos: P11226(Tbio)
UniProt: P11226
LinkDB All DBs
Structure
PDB: 

Position
10q21.1
AA seq 248 aa AA seqDB search
MSLFPSLPLLLLSMVAASYSETVTCEDAQKTCPAVIACSSPGINGFPGKDGRDGTKGEKG
EPGQGLRGLQGPPGKLGPPGNPGPSGSPGPKGQKGDPGKSPDGDSSLAASERKALQTEMA
RIKKWLTFSLGKQVGNKFFLTNGEIMTFEKVKALCVKFQASVATPRNAAENGAIQNLIKE
EAFLGITDEKTEGQFVDLTGNRLTYTNWNEGEPNNAGSDEDCVLLLKNGQWNDVPCSTSH
LAVCEFPI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgtttccatcactccctctccttctcctgagtatggtggcagcgtcttactca
gaaactgtgacctgtgaggatgcccaaaagacctgccctgcagtgattgcctgtagctct
ccaggcatcaacggcttcccaggcaaagatgggcgtgatggcaccaagggagaaaagggg
gaaccaggccaagggctcagaggcttacagggcccccctggaaagttggggcctccagga
aatccagggccttctgggtcaccaggaccaaagggccaaaaaggagaccctggaaaaagt
ccggatggtgatagtagcctggctgcctcagaaagaaaagctctgcaaacagaaatggca
cgtatcaaaaagtggctcaccttctctctgggcaaacaagttgggaacaagttcttcctg
accaatggtgaaataatgacctttgaaaaagtgaaggccttgtgtgtcaagttccaggcc
tctgtggccacccccaggaatgctgcagagaatggagccattcagaatctcatcaaggag
gaagccttcctgggcatcactgatgagaagacagaagggcagtttgtggatctgacagga
aatagactgacctacacaaactggaacgagggtgaacccaacaatgctggttctgatgaa
gattgtgtattgctactgaaaaatggccagtggaatgacgtcccctgctccacctcccat
ctggccgtctgtgagttccctatctga

KEGG   Homo sapiens (human): 6441Help
Entry
6441              CDS       T01001                                 

Gene name
SFTPD, COLEC7, PSP-D, SFTP4, SP-D
Definition
(RefSeq) surfactant protein D
  KO
K10068  pulmonary surfactant-associated protein D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    6441 (SFTPD)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6441 (SFTPD)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    6441 (SFTPD)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    6441 (SFTPD)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 3: Collectins
   6441 (SFTPD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen Surfac_D-trimer Lectin_C DUF4982 DUF3138 NPV_P10
Motif
Other DBs
NCBI-GeneID: 6441
NCBI-ProteinID: NP_003010
OMIM: 178635
HGNC: 10803
Ensembl: ENSG00000133661
Vega: OTTHUMG00000018590
Pharos: P35247(Tbio)
UniProt: P35247
LinkDB All DBs
Structure
PDB: 

Position
10q22.3
AA seq 375 aa AA seqDB search
MLLFLLSALVLLTQPLGYLEAEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPR
GEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGRE
GPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNT
GAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQH
LQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAAL
QQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKW
NDRACGEKRLVVCEF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgctgctcttcctcctctctgcactggtcctgctcacacagcccctgggctacctggaa
gcagaaatgaagacctactcccacagaacaatgcccagtgcttgcaccctggtcatgtgt
agctcagtggagagtggcctgcctggtcgcgatggacgggatgggagagagggccctcgg
ggcgagaagggggacccaggtttgccaggagctgcagggcaagcagggatgcctggacaa
gctggcccagttgggcccaaaggggacaatggctctgttggagaacctggaccaaaggga
gacactgggccaagtggacctccaggacctcccggtgtgcctggtccagctggaagagaa
ggtcccctggggaagcaggggaacataggacctcagggcaagccaggcccaaaaggagaa
gctgggcccaaaggagaagtaggtgccccaggcatgcagggctcggcaggggcaagaggc
ctcgcaggccctaagggagagcgaggtgtccctggtgagcgtggagtccctggaaacaca
ggggcagcagggtctgctggagccatgggtccccagggaagtccaggtgccaggggaccc
ccgggattgaagggggacaaaggcattcctggagacaaaggagcaaagggagaaagtggg
cttccagatgttgcttctctgaggcagcaggttgaggccttacagggacaagtacagcac
ctccaggctgctttctctcagtataagaaagttgagctcttcccaaatggccaaagtgtc
ggggagaagattttcaagacagcaggctttgtaaaaccatttacggaggcacagctgctg
tgcacacaggctggtggacagttggcctctccacgctctgccgctgagaatgccgccttg
caacagctggtcgtagctaagaacgaggctgctttcctgagcatgactgattccaagaca
gagggcaagttcacctaccccacaggagagtccctggtctattccaactgggccccaggg
gagcccaacgatgatggcgggtcagaggactgtgtggagatcttcaccaatggcaagtgg
aatgacagggcttgtggagaaaagcgtcttgtggtctgcgagttctga

KEGG   Homo sapiens (human): 653509Help
Entry
653509            CDS       T01001                                 

Gene name
SFTPA1, COLEC4, PSAP, PSP-A, PSPA, SFTP1, SFTPA1B, SP-A, SP-A1, SP-A1_beta, SP-A1_delta, SP-A1_epsilon, SP-A1_gamma, SPA, SPA1
Definition
(RefSeq) surfactant protein A1
  KO
K10067  pulmonary surfactant-associated protein A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa05133  Pertussis
Disease
H01299  Idiopathic pulmonary fibrosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    653509 (SFTPA1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    653509 (SFTPA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    653509 (SFTPA1)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    653509 (SFTPA1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    653509 (SFTPA1)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 3: Collectins
   653509 (SFTPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C Collagen
Motif
Other DBs
NCBI-GeneID: 653509
NCBI-ProteinID: NP_001158116
OMIM: 178630
HGNC: 10798
Ensembl: ENSG00000122852
Vega: OTTHUMG00000018565
Pharos: Q8IWL2(Tbio)
UniProt: Q8IWL2 A0A024QZP2
LinkDB All DBs
Position
10q22.3
AA seq 248 aa AA seqDB search
MWLCPLALNLILMAASGAVCEVKDVCVGSPGIPGTPGSHGLPGRDGRDGLKGDPGPPGPM
GPPGEMPCPPGNDGLPGAPGIPGECGEKGEPGERGPPGLPAHLDEELQATLHDFRHQILQ
TRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKK
YNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLY
SRLTICEF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgtgccctctggccctcaacctcatcttgatggcagcctctggtgctgtgtgc
gaagtgaaggacgtttgtgttggaagccctggtatccccggcactcctggatcccacggc
ctgccaggcagggacgggagagatggtctcaaaggagaccctggccctccaggccccatg
ggtccacctggagaaatgccatgtcctcctggaaatgatgggctgcctggagcccctggt
atccctggagagtgtggagagaagggggagcctggcgagaggggccctccagggcttcca
gctcatctagatgaggagctccaagccacactccacgactttagacatcaaatcctgcag
acaaggggagccctcagtctgcagggctccataatgacagtaggagagaaggtcttctcc
agcaatgggcagtccatcacttttgatgccattcaggaggcatgtgccagagcaggcggc
cgcattgctgtcccaaggaatccagaggaaaatgaggccattgcaagcttcgtgaagaag
tacaacacatatgcctatgtaggcctgactgagggtcccagccctggagacttccgctac
tcagacgggacccctgtaaactacaccaactggtaccgaggggagcccgcaggtcgggga
aaagagcagtgtgtggagatgtacacagatgggcagtggaatgacaggaactgcctgtac
tcccgactgaccatctgtgagttctga

KEGG   Homo sapiens (human): 729238Help
Entry
729238            CDS       T01001                                 

Gene name
SFTPA2, COLEC5, PSAP, PSP-A, PSPA, SFTP1, SFTPA2B, SP-2A, SP-A, SPA2, SPAII
Definition
(RefSeq) surfactant protein A2
  KO
K10067  pulmonary surfactant-associated protein A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa05133  Pertussis
Disease
H01299  Idiopathic pulmonary fibrosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    729238 (SFTPA2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05133 Pertussis
    729238 (SFTPA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    729238 (SFTPA2)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    729238 (SFTPA2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    729238 (SFTPA2)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 3: Collectins
   729238 (SFTPA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C Collagen
Motif
Other DBs
NCBI-GeneID: 729238
NCBI-ProteinID: NP_001092138
OMIM: 178642
HGNC: 10799
Ensembl: ENSG00000185303
Vega: OTTHUMG00000018566
Pharos: Q8IWL1(Tbio)
UniProt: Q8IWL1
LinkDB All DBs
Position
10q22.3
AA seq 248 aa AA seqDB search
MWLCPLALTLILMAASGAACEVKDVCVGSPGIPGTPGSHGLPGRDGRDGVKGDPGPPGPM
GPPGETPCPPGNNGLPGAPGVPGERGEKGEAGERGPPGLPAHLDEELQATLHDFRHQILQ
TRGALSLQGSIMTVGEKVFSSNGQSITFDAIQEACARAGGRIAVPRNPEENEAIASFVKK
YNTYAYVGLTEGPSPGDFRYSDGTPVNYTNWYRGEPAGRGKEQCVEMYTDGQWNDRNCLY
SRLTICEF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtggctgtgccctctggccctcaccctcatcttgatggcagcctctggtgctgcgtgc
gaagtgaaggacgtttgtgttggaagccctggtatccccggcactcctggatcccacggc
ctgccaggcagggacgggagagatggtgtcaaaggagaccctggccctccaggccccatg
ggtccgcctggagaaacaccatgtcctcctgggaataatgggctgcctggagcccctggt
gtccctggagagcgtggagagaagggggaggctggcgagagaggccctccagggcttcca
gctcatctagatgaggagctccaagccacactccacgacttcagacatcaaatcctgcag
acaaggggagccctcagtctgcagggctccataatgacagtaggagagaaggtcttctcc
agcaatgggcagtccatcacttttgatgccattcaggaggcatgtgccagagcaggcggc
cgcattgctgtcccaaggaatccagaggaaaatgaggccattgcaagcttcgtgaagaag
tacaacacatatgcctatgtaggcctgactgagggtcccagccctggagacttccgctac
tcagatgggacccctgtaaactacaccaactggtaccgaggggagcctgcaggtcgggga
aaagagcagtgtgtggagatgtacacagatgggcagtggaatgacaggaactgcctgtac
tcccgactgaccatctgtgagttctga

KEGG   Homo sapiens (human): 78989Help
Entry
78989             CDS       T01001                                 

Gene name
COLEC11, 3MC2, CL-K1-I, CL-K1-II, CL-K1-IIa, CL-K1-IIb, CLK1
Definition
(RefSeq) collectin subfamily member 11
  KO
K10066  collectin sub-family member 11
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
Disease
H01887  3MC syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    78989 (COLEC11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    78989 (COLEC11)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    78989 (COLEC11)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    78989 (COLEC11)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 3: Collectins
   78989 (COLEC11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C Collagen
Motif
Other DBs
NCBI-GeneID: 78989
NCBI-ProteinID: NP_076932
OMIM: 612502
HGNC: 17213
Ensembl: ENSG00000118004
Vega: OTTHUMG00000090304
Pharos: Q9BWP8(Tbio)
UniProt: Q9BWP8
LinkDB All DBs
Structure
PDB: 

Position
2p25.3
AA seq 271 aa AA seqDB search
MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLKGDAGEKGDKGAPGRPGR
VGPTGEKGDMGDKGQKGSVGRHGKIGPIGSKGEKGDSGDIGPPGPNGEPGLPCECSQLRK
AIGEMDNQVSQLTSELKFIKNAVAGVRETESKIYLLVKEEKRYADAQLSCQGRGGTLSMP
KDEAANGLMAAYLAQAGLARVFIGINDLEKEGAFVYSDHSPMRTFNKWRSGEPNNAYDEE
DCVEMVASGGWNDVACHTTMYFMCEFDKENM
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagggggaatctggccctggtgggcgttctaatcagcctggccttcctgtcactgctg
ccatctggacatcctcagccggctggcgatgacgcctgctctgtgcagatcctcgtccct
ggcctcaaaggggatgcgggagagaagggagacaaaggcgcccccggacggcctggaaga
gtcggccccacgggagaaaaaggagacatgggggacaaaggacagaaaggcagtgtgggt
cgtcatggaaaaattggtcccattggctctaaaggtgagaaaggagattccggtgacata
ggaccccctggtcctaatggagaaccaggcctcccatgtgagtgcagccagctgcgcaag
gccatcggggagatggacaaccaggtctctcagctgaccagcgagctcaagttcatcaag
aatgctgtcgccggtgtgcgcgagacggagagcaagatctacctgctggtgaaggaggag
aagcgctacgcggacgcccagctgtcctgccagggccgcgggggcacgctgagcatgccc
aaggacgaggctgccaatggcctgatggccgcatacctggcgcaagccggcctggcccgt
gtcttcatcggcatcaacgacctggagaaggagggcgccttcgtgtactctgaccactcc
cccatgcggaccttcaacaagtggcgcagcggtgagcccaacaatgcctacgacgaggag
gactgcgtggagatggtggcctcgggcggctggaacgacgtggcctgccacaccaccatg
tacttcatgtgtgagtttgacaaggagaacatgtga

KEGG   Homo sapiens (human): 81035Help
Entry
81035             CDS       T01001                                 

Gene name
COLEC12, CLP1, NSR2, SCARA4, SRCL
Definition
(RefSeq) collectin subfamily member 12
  KO
K10062  collectin sub-family member 12
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    81035 (COLEC12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    81035 (COLEC12)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:hsa04091]
    81035 (COLEC12)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Opsonins
    81035 (COLEC12)
Lectins [BR:hsa04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Scavenger receptor with a CTLD (SRCL)
    81035 (COLEC12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Collagen Lectin_C Filament KxDL Golgin_A5 GIT1_C MscS_porin SepF Fez1
Motif
Other DBs
NCBI-GeneID: 81035
NCBI-ProteinID: NP_569057
OMIM: 607621
HGNC: 16016
Ensembl: ENSG00000158270
Vega: OTTHUMG00000178145
Pharos: Q5KU26(Tbio)
UniProt: Q5KU26
LinkDB All DBs
Structure
PDB: 

Position
18p11.32
AA seq 742 aa AA seqDB search
MKDDFAEEEEVQSFGYKRFGIQEGTQCTKCKNNWALKFSIILLYILCALLTITVAILGYK
VVEKMDNVTGGMETSRQTYDDKLTAVESDLKKLGDQTGKKAISTNSELSTFRSDILDLRQ
QLREITEKTSKNKDTLEKLQASGDALVDRQSQLKETLENNSFLITTVNKTLQAYNGYVTN
LQQDTSVLQGNLQNQMYSHNVVIMNLNNLNLTQVQQRNLITNLQRSVDDTSQAIQRIKND
FQNLQQVFLQAKKDTDWLKEKVQSLQTLAANNSALAKANNDTLEDMNSQLNSFTGQMENI
TTISQANEQNLKDLQDLHKDAENRTAIKFNQLEERFQLFETDIVNIISNISYTAHHLRTL
TSNLNEVRTTCTDTLTKHTDDLTSLNNTLANIRLDSVSLRMQQDLMRSRLDTEVANLSVI
MEEMKLVDSKHGQLIKNFTILQGPPGPRGPRGDRGSQGPPGPTGNKGQKGEKGEPGPPGP
AGERGPIGPAGPPGERGGKGSKGSQGPKGSRGSPGKPGPQGSSGDPGPPGPPGKEGLPGP
QGPPGFQGLQGTVGEPGVPGPRGLPGLPGVPGMPGPKGPPGPPGPSGAVVPLALQNEPTP
APEDNGCPPHWKNFTDKCYYFSVEKEIFEDAKLFCEDKSSHLVFINTREEQQWIKKQMVG
RESHWIGLTDSERENEWKWLDGTSPDYKNWKAGQPDNWGHGHGPGEDCAGLIYAGQWNDF
QCEDVNNFICEKDRETVLSSAL
NT seq 2229 nt NT seq  +upstreamnt  +downstreamnt
atgaaagacgacttcgcagaggaggaggaggtgcaatccttcggttacaagcggtttggt
attcaggaaggaacacaatgtaccaaatgtaaaaataactgggcactgaagttttctatc
atattattatacattttgtgtgccttgctaacaatcacagtagccattttgggatataaa
gttgtagagaaaatggacaatgtcacaggtggcatggaaacatctcgccaaacctatgat
gacaagctcacagcagtggaaagtgacctgaaaaaattaggtgaccaaactgggaagaaa
gctatcagcaccaactcagaactctccaccttcagatcagacattctagatctccgtcag
caacttcgtgagattacagaaaaaaccagcaagaacaaggatacgctggagaagttacag
gcgagcggggatgctctggtggacaggcagagtcaattgaaagaaactttggagaataac
tctttcctcatcaccactgtaaacaaaaccctccaggcgtataatggctatgtcacgaat
ctgcagcaagataccagcgtgctccagggcaatctgcagaaccaaatgtattctcataat
gtggtcatcatgaacctcaacaacctgaacctgacccaggtgcagcagaggaacctcatc
acgaatctgcagcggtctgtggatgacacaagccaggctatccagcgaatcaagaacgac
tttcaaaatctgcagcaggtttttcttcaagccaagaaggacacggattggctgaaggag
aaagtgcagagcttgcagacgctggctgccaacaactctgcgttggccaaagccaacaac
gacaccctggaggatatgaacagccagctcaactcattcacaggtcagatggagaacatc
accactatctctcaagccaacgagcagaacctgaaagacctgcaggacttacacaaagat
gcagagaatagaacagccatcaagttcaaccaactggaggaacgcttccagctctttgag
acggatattgtgaacatcattagcaatatcagttacacagcccaccacctgcggacgctg
accagcaatctaaatgaagtcaggaccacttgcacagatacccttaccaaacacacagat
gatctgacctccttgaataataccctggccaacatccgtttggattctgtttctctcagg
atgcaacaagatttgatgaggtcgaggttagacactgaagtagccaacttatcagtgatt
atggaagaaatgaagctagtagactccaagcatggtcagctcatcaagaattttacaata
ctacaaggtccaccgggccccaggggtccaagaggtgacagaggatcccagggaccccct
ggcccaactggcaacaagggacagaaaggagagaagggggagcctggaccacctggccct
gcgggtgagagaggcccaattggaccagctggtccccccggagagcgtggcggcaaagga
tctaaaggctcccagggccccaaaggctcccgtggttcccctgggaagcccggccctcag
ggctccagtggggacccaggccccccgggcccaccaggcaaagagggactccccggccct
cagggccctcctggcttccagggacttcagggcaccgttggggagcctggggtgcctgga
cctcggggactgccaggcttgcctggggtaccaggcatgccaggccccaagggccccccc
ggccctcctggcccatcaggagcggtggtgcccctggccctgcagaatgagccaacccca
gcaccggaggacaatggctgcccgcctcactggaagaacttcacagacaaatgctactat
ttttcagttgagaaagaaatttttgaggatgcaaagcttttctgtgaagacaagtcttca
catcttgttttcataaacactagagaggaacagcaatggataaaaaaacagatggtaggg
agagagagccactggatcggcctcacagactcagagcgtgaaaatgaatggaagtggctg
gatgggacatctccagactacaaaaattggaaagctggacagccggataactggggtcat
ggccatgggccaggagaagactgtgctgggttgatttatgctgggcagtggaacgatttc
caatgtgaagacgtcaataacttcatttgcgaaaaagacagggagacagtactgtcatct
gcattataa

DBGET integrated database retrieval system