KEGG   Homo sapiens (human): 4210Help
Entry
4210              CDS       T01001                                 

Gene name
MEFV, FMF, MEF, TRIM20
Definition
(RefSeq) MEFV, pyrin innate immunity regulator
  KO
K12803  pyrin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04621  NOD-like receptor signaling pathway
Disease
H00288  Familial Mediterranean fever (FMF)
H01516  Adult onset Still's disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    4210 (MEFV)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Other autophagy associated proteins
   TRIM-directed selective autophagy
    4210 (MEFV)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PYRIN PRY SPRY zf-B_box 7TMR-HDED
Motif
Other DBs
NCBI-GeneID: 4210
NCBI-ProteinID: NP_000234
OMIM: 608107
HGNC: 6998
Ensembl: ENSG00000103313
Vega: OTTHUMG00000129324
Pharos: O15553(Tbio)
UniProt: O15553
LinkDB All DBs
Structure
PDB: 

Position
16p13.3
AA seq 781 aa AA seqDB search
MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKMATLLVTY
YGEEYAVQLTLQVLRAINQRLLAEELHRAAIQEYSTQENGTDDSAASSSLGENKPRSLKT
PDHPEGNEGNGPRPYGGGAASLRCSQPEAGRGLSRKPLSKRREKASEGLDAQGKPRTRSP
ALPGGRSPGPCRALEGGQAEVRLRRNASSAGRLQGLAGGAPGQKECRPFEVYLPSGKMRP
RSLEVTISTGEKAPANPEILLTLEEKTAANLDSATEPRARPTPDGGASADLKEGPGNPEH
SVTGRPPDTAASPRCHAQEGDPVDGTCVRDSCSFPEAVSGHPQASGSRSPGCPRCQDSHE
RKSPGSLSPQPLPQCKRHLKQVQLLFCEDHDEPICLICSLSQEHQGHRVRPIEEVALEHK
KKIQKQLEHLKKLRKSGEEQRSYGEEKAVSFLKQTEALKQRVQRKLEQVYYFLEQQEHFF
VASLEDVGQMVGQIRKAYDTRVSQDIALLDALIGELEAKECQSEWELLQDIGDILHRAKT
VPVPEKWTTPQEIKQKIQLLHQKSEFVEKSTKYFSETLRSEMEMFNVPELIGAQAHAVNV
ILDAETAYPNLIFSDDLKSVRLGNKWERLPDGPQRFDSCIIVLGSPSFLSGRRYWEVEVG
DKTAWILGACKTSISRKGNMTLSPENGYWVVIMMKENEYQASSVPPTRLLIKEPPKRVGI
FVDYRVGSISFYNVTARSHIYTFASCSFSGPLQPIFSPGTRDGGKNTAPLTICPVGGQGP
D
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atggctaagacccctagtgaccatctgctgtccaccctggaggagctggtgccctatgac
ttcgagaagttcaagttcaagctgcagaacaccagtgtgcagaaggagcactccaggatc
ccccggagccagatccagagagccaggccggtgaagatggccactctgctggtcacctac
tatggggaagagtacgccgtgcagctcaccctgcaggtcctgcgggccatcaaccagcgc
ctgctggccgaggagctccacagggcagccattcaggaatattccacacaagaaaacggc
acagatgattccgcagcgtccagctccctgggggagaacaagcccaggagcctgaagact
ccagaccaccccgaggggaacgaggggaacggccctcggccgtacgggggcggagctgcc
agcctgcggtgcagccagcccgaggccgggagggggctgtcgaggaagcccctgagcaaa
cgcagagagaaggcctcggagggcctggacgcgcagggcaagcctcggacccggagcccg
gccctgccgggcgggagaagccccggcccctgcagggcgctagaggggggccaggccgag
gtccggctgcgcagaaacgccagctccgcggggaggctgcaggggctggcggggggcgcc
ccggggcagaaggagtgcaggcccttcgaagtgtacctgccctcgggaaagatgcgacct
agaagccttgaggtcaccatttctacaggggagaaggcgcccgcaaatccagaaattctc
ctgactctagaggaaaagacagctgcgaatctggactcggcaacagaaccccgggcaagg
cccactccggatggaggggcatctgcggacctgaaggaaggccctggaaatccagaacat
tcggtcaccggaaggccaccagacacggctgcgagtccccgctgccacgcccaggaagga
gacccagttgacggtacctgtgtgcgtgattcctgcagcttccccgaggcagtttctggg
cacccccaggcctcaggcagccgctcacctggctgcccccggtgccaggactcccatgaa
aggaagagcccgggaagcctaagcccccagcccctgccacagtgtaagcgccacctgaag
caggtccagctgctcttctgtgaggatcacgatgagcccatctgcctcatctgcagtctg
agtcaggagcaccaaggccaccgggtgcgccccattgaggaggtcgccctggaacacaag
aagaaaattcagaagcagctggagcatctgaagaagctgagaaaatcaggggaggagcag
cgatcctatggggaggagaaggcagtgagctttctgaaacaaactgaagcgctgaagcag
cgggtgcagaggaagctggagcaggtgtactacttcctggagcagcaagagcatttcttt
gtggcctcactggaggacgtgggccagatggttgggcagatcaggaaggcatatgacacc
cgcgtatcccaggacatcgccctgctcgatgcgctgattggggaactggaggccaaggag
tgccagtcagaatgggaacttctgcaggacattggagacatcttgcacagggctaagaca
gtgcctgtccctgaaaagtggaccactcctcaagagataaaacaaaagatccaactcctc
caccagaagtcagagtttgtggagaagagcacaaagtacttctcagaaaccctgcgttca
gaaatggaaatgttcaatgttccagagctgattggcgctcaggcacatgctgttaatgtg
attctggatgcagaaaccgcttaccccaacctcatcttctctgatgatctgaagagtgtt
agacttggaaacaagtgggagaggctgcctgatggcccgcaaagatttgacagctgtatc
attgttctgggctctccgagtttcctctctggccgccgttactgggaggtggaggttgga
gacaagacagcatggatcctgggagcctgcaagacatccataagcaggaaagggaacatg
actctgtcgccagagaatggctactgggtggtgataatgatgaaggaaaatgagtaccag
gcgtccagcgttcccccgacccgcctgctaataaaggagcctcccaagcgtgtgggcatc
ttcgtggactacagagttggaagcatctccttttacaatgtgacagccagatcccacatc
tatacattcgccagctgctctttctctgggccccttcaacctatcttcagccctgggaca
cgtgatggagggaagaacacagctcctctgactatctgtccagtgggtggtcaggggcct
gactga

DBGET integrated database retrieval system