KEGG   Homo sapiens (human): 4212
Entry
4212              CDS       T01001                                 

Gene name
MEIS2, CPCMR, HsT18361, MRG1
Definition
(RefSeq) Meis homeobox 2
  KO
K16670  homeobox protein Meis2
Organism
hsa  Homo sapiens (human)
Disease
H02394  Cleft palate, cardiac defects, and mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4212 (MEIS2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, MEIS
    4212 (MEIS2)
SSDB
Motif
Pfam: Meis_PKNOX_N Homeobox_KN Homeodomain
Other DBs
NCBI-GeneID: 4212
NCBI-ProteinID: NP_733775
OMIM: 601740
HGNC: 7001
Ensembl: ENSG00000134138
Vega: OTTHUMG00000129781
Pharos: O14770(Tbio)
UniProt: O14770 B3KPD8
LinkDB
Structure
PDB: 

Position
15q14
AA seq 477 aa
MAQRYDELPHYGGMDGVGVPASMYGDPHAPRPIPPVHHLNHGPPLHATQHYGAHAPHPNV
MPASMGSAVNDALKRDKDAIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFN
EDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLK
GKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPSSWRDHDDATSTHSAGTPGPSSGGH
ASQSGDNSSEQGDGLDNSVASPGTGDDDDPDKDKKRQKKRGIFPKVATNIMRAWLFQHLT
HPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMIDQSNRAGFLLDPSVSQGAAYS
PEGQPMGSFVLDGQQHMGIRPAGLQSMPGDYVSQGGPMGMSMAQPSYTPPQMTPHPTQLR
HGPPMHSYLPSHPHHPAMMMHGGPPTHPGMTMSAQSPTMLNSVDPNVGGQVMDIHAQ
NT seq 1434 nt   +upstreamnt  +downstreamnt
atggcgcaaaggtacgatgagctgccccattacggcgggatggacggagtaggggttccc
gcttccatgtacggagaccctcacgcgccgcggccgatccccccggttcaccacctgaac
cacgggccgccgctccacgccacacagcactacggcgcgcacgccccgcaccccaatgtc
atgccggccagtatgggatccgctgtcaacgacgccttgaagcgggacaaggacgcgatc
tatgggcacccgttgtttcctctgttagctctggtctttgagaagtgcgagctggcgacc
tgcactccccgggaacctggagtggctggcggagacgtctgctcctccgactccttcaac
gaggacatcgcggtcttcgccaagcaggttcgcgccgaaaagccacttttttcctcaaat
ccagagctggacaatttgatgatacaagcaatacaagtactaaggtttcatcttttggag
ttagaaaaggtccacgaactgtgcgataacttctgccaccgatacattagctgtttgaag
gggaaaatgcccatcgacctcgtcattgatgaaagagacggcagctccaagtcagatcat
gaagaactttcaggctcctccacaaatctcgctgaccataacccttcttcttggcgagac
cacgatgatgcaacctcaacccactcagcaggcaccccagggccctccagtgggggccat
gcttcccagagcggagacaacagcagtgagcaaggggatggtttagacaacagtgtagct
tcacctggtacaggtgacgatgatgatccggataaggacaaaaaacgccagaagaaaaga
ggcattttccccaaagtagcaacaaatatcatgagagcatggctcttccagcatctcaca
catccgtacccttccgaagagcagaagaaacagttagcgcaagacacaggacttacaatt
ctccaagtaaacaactggtttattaatgccagaagaagaatagtacagcccatgattgac
cagtcaaatcgagcaggttttcttcttgatccttcagtgagccaaggagcagcatatagt
ccagagggtcagcccatggggagctttgtgttggatggtcagcaacacatggggatccgg
cctgcaggtttgcagagcatgccaggggactacgtttctcagggtggtcctatgggaatg
agtatggcacagccaagttacactcctccccagatgaccccacaccctactcaattaaga
catggacccccaatgcattcatatttgccaagccatccccaccacccagccatgatgatg
cacggaggaccccctacccaccctggaatgactatgtcagcacagagccccacaatgtta
aattctgtagatcccaatgttggcggacaggttatggacattcatgcccaatag

DBGET integrated database retrieval system