KEGG   Homo sapiens (human): 4242Help
Entry
4242              CDS       T01001                                 

Gene name
MFNG
Definition
(RefSeq) MFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
  KO
K05948  fringe [EC:2.4.1.222]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00514  Other types of O-glycan biosynthesis
hsa04330  Notch signaling pathway
hsa05165  Human papillomavirus infection
Network
nt06116  NOTCH signaling (viruses)
nt06166  Human papillomavirus (HPV)
  Element
N00381  HPV E6 to Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    4242 (MFNG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    4242 (MFNG)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    4242 (MFNG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    4242 (MFNG)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.222  O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
     4242 (MFNG)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  O-Glycan
   4242 (MFNG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fringe Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 4242
NCBI-ProteinID: NP_002396
OMIM: 602577
HGNC: 7038
Ensembl: ENSG00000100060
Vega: OTTHUMG00000150560
Pharos: O00587(Tbio)
UniProt: O00587
LinkDB All DBs
Position
22q13.1
AA seq 321 aa AA seqDB search
MQCRLPRGLAGALLTLLCMGLLCLRYHLNLSPQRVQGTPELSQPNPGPPKLQLHDVFIAV
KTTRAFHRLRLELLLDTWVSRTREQTFVFTDSPDKGLQERLGSHLVVTNCSAEHSHPALS
CKMAAEFDTFLASGLRWFCHVDDDNYVNPRALLQLLRAFPLARDVYVGRPSLNRPIHASE
PQPHNRTRLVQFWFATGGAGFCINRKLALKMAPWASGSRFMDTSALIRLPDDCTMGYIIE
CKLGGRLQPSPLFHSHLETLQLLRTAQLPEQVTLSYGVFEGKLNVIKLQGPFSPEEDPSR
FRSLHCLLYPDTPWCPQLGAR
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcagtgccggctcccgcggggcctggctggagccctcctcaccctcctgtgcatgggg
ctcctgtgtctgcggtaccacttgaacctgtccccgcagcgggtacaagggacccccgag
ctgagccagccgaacccggggccccctaagctacagctacacgatgtcttcattgcagtg
aagacgacccgggctttccaccgcttgcgcctggagctgctgcttgacacgtgggtttcc
aggaccagggaacagacatttgtcttcaccgacagcccagacaaaggcctccaggagaga
ctggggtcccaccttgtggtcaccaactgctccgcggaacacagccacccagctctgtcc
tgcaagatggctgctgagttcgacaccttcttggccagtgggcttaggtggttctgccat
gtggacgatgacaactatgtgaacccaagggcgctgctgcagcttctgagagccttcccg
ctggcccgcgacgtctatgtgggaaggcccagcctgaaccggcccatccatgcctcagag
ccacagccccacaaccgcacgaggctggtacagttctggtttgccactgggggtgctggc
ttctgcatcaatcgcaaactggctttgaagatggctccgtgggccagtggctcccgtttc
atggacacatctgctctcatccggctgcctgatgactgcaccatgggctatatcattgag
tgcaagctgggcggccgcctgcagcccagccccctctttcactcccacctggagaccctg
cagctgctgaggactgcacagctcccagaacaggtcaccctcagctacggtgtctttgag
gggaaactcaacgtcattaagctacagggccccttctccccggaggaggacccctccaga
tttcgctccctccattgtctgctctatccagatacaccctggtgtccccagctgggtgcc
cgatga

DBGET integrated database retrieval system