KEGG   Homo sapiens (human): 4258Help
Entry
4258              CDS       T01001                                 

Gene name
MGST2, GST2, MGST-II
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00480  Glutathione metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa01524  Platinum drug resistance
hsa05200  Pathways in cancer
hsa05204  Chemical carcinogenesis
hsa05225  Hepatocellular carcinoma
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06226  KEAP1-NRF2 signaling
nt06263  Hepatocellular carcinoma
  Element
N00243  KEAP1-NRF2 signaling pathway
N00244  Mutation-inactivated KEAP1 to KEAP1-NRF2 signaling pathway
N00245  Mutation-activated NRF2 to KEAP1-NRF2 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    4258 (MGST2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    4258 (MGST2)
   00982 Drug metabolism - cytochrome P450
    4258 (MGST2)
   00983 Drug metabolism - other enzymes
    4258 (MGST2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    4258 (MGST2)
   05204 Chemical carcinogenesis
    4258 (MGST2)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    4258 (MGST2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    4258 (MGST2)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    4258 (MGST2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    4258 (MGST2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     4258 (MGST2)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   4258 (MGST2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 4258
NCBI-ProteinID: NP_001191295
OMIM: 601733
HGNC: 7063
Ensembl: ENSG00000085871
Vega: OTTHUMG00000133382
Pharos: Q99735(Tbio)
UniProt: Q99735
LinkDB All DBs
Position
4q31.1
AA seq 147 aa AA seqDB search
MAGNSILLAAVSILSACQQSYFALQVGKARLKYKVTPPAVTGSPEFERVFRAQQNCVEFY
PIFIITLWMAGWYFNQVFATCLGLVYIYGRHLYFWGYSEAAKKRITGFRLSLGILALLTL
LGALGIANSFLDEYLDLNIAKKLRRQF
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggccgggaactcgatcctgctggctgctgtctctattctctcggcctgtcagcaaagt
tattttgctttgcaagttggaaaggcaagattaaaatacaaagttacgcccccagcagtc
actgggtcaccagagtttgagagagtatttcgggcacaacaaaactgtgtggagttttat
cctatattcataattacattgtggatggctgggtggtatttcaaccaagtttttgctact
tgtctgggtctggtgtacatatatggccgtcacctatacttctggggatattcagaagct
gctaaaaaacggatcaccggtttccgactgagtctggggattttggccttgttgaccctc
ctaggtgccctgggaattgcaaacagctttctggatgaatatctggacctcaatattgcc
aagaaactgaggcggcaattctaa

DBGET integrated database retrieval system