KEGG   Homo sapiens (human): 4261
Entry
4261              CDS       T01001                                 

Gene name
CIITA, C2TA, CIITAIV, MHC2TA, NLRA
Definition
(RefSeq) class II major histocompatibility complex transactivator
  KO
K08060  MHC class II transactivator [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04612  Antigen processing and presentation
hsa05145  Toxoplasmosis
hsa05152  Tuberculosis
hsa05164  Influenza A
hsa05340  Primary immunodeficiency
Disease
H00093  Combined immunodeficiency
H00985  Bare lymphocyte syndrome type2
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    4261 (CIITA)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    4261 (CIITA)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    4261 (CIITA)
  09172 Infectious disease: viral
   05164 Influenza A
    4261 (CIITA)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    4261 (CIITA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4261 (CIITA)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    4261 (CIITA)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     4261 (CIITA)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  TAF1 family
   4261 (CIITA)
Pattern recognition receptors [BR:hsa04054]
 Cytoplasmic pattern recognition receptors
  NOD-like receptors
   4261 (CIITA)
SSDB
Motif
Pfam: NACHT LRR_6 NLRC4_HD2 LRR_8 LRR_4 LRR_9
Other DBs
NCBI-GeneID: 4261
NCBI-ProteinID: NP_000237
OMIM: 600005
HGNC: 7067
Ensembl: ENSG00000179583
Vega: OTTHUMG00000129753
Pharos: P33076(Tbio)
UniProt: P33076 Q66X48 A0A0B4J1S1
LinkDB
Position
16p13.13
AA seq 1130 aa
MRCLAPRPAGSYLSEPQGSSQCATMELGPLEGGYLELLNSDADPLCLYHFYDQMDLAGEE
EIELYSEPDTDTINCDQFSRLLCDMEGDEETREAYANIAELDQYVFQDSQLEGLSKDIFK
HIGPDEVIGESMEMPAEVGQKSQKRPFPEELPADLKHWKPAEPPTVVTGSLLVGPVSDCS
TLPCLPLPALFNQEPASGQMRLEKTDQIPMPFSSSSLSCLNLPEGPIQFVPTISTLPHGL
WQISEAGTGVSSIFIYHGEVPQASQVPPPSGFTVHGLPTSPDRPGSTSPFAPSATDLPSM
PEPALTSRANMTEHKTSPTQCPAAGEVSNKLPKWPEPVEQFYRSLQDTYGAEPAGPDGIL
VEVDLVQARLERSSSKSLERELATPDWAERQLAQGGLAEVLLAAKEHRRPRETRVIAVLG
KAGQGKSYWAGAVSRAWACGRLPQYDFVFSVPCHCLNRPGDAYGLQDLLFSLGPQPLVAA
DEVFSHILKRPDRVLLILDGFEELEAQDGFLHSTCGPAPAEPCSLRGLLAGLFQKKLLRG
CTLLLTARPRGRLVQSLSKADALFELSGFSMEQAQAYVMRYFESSGMTEHQDRALTLLRD
RPLLLSHSHSPTLCRAVCQLSEALLELGEDAKLPSTLTGLYVGLLGRAALDSPPGALAEL
AKLAWELGRRHQSTLQEDQFPSADVRTWAMAKGLVQHPPRAAESELAFPSFLLQCFLGAL
WLALSGEIKDKELPQYLALTPRKKRPYDNWLEGVPRFLAGLIFQPPARCLGALLGPSAAA
SVDRKQKVLARYLKRLQPGTLRARQLLELLHCAHEAEEAGIWQHVVQELPGRLSFLGTRL
TPPDAHVLGKALEAAGQDFSLDLRSTGICPSGLGSLVGLSCVTRFRAALSDTVALWESLQ
QHGETKLLQAAEEKFTIEPFKAKSLKDVEDLGKLVQTQRTRSSSEDTAGELPAVRDLKKL
EFALGPVSGPQAFPKLVRILTAFSSLQHLDLDALSENKIGDEGVSQLSATFPQLKSLETL
NLSQNNITDLGAYKLAEALPSLAASLLRLSLYNNCICDVGAESLARVLPDMVSLRVMDVQ
YNKFTAAGAQQLAASLRRCPHVETLAMWTPTIPFSVQEHLQQQDSRISLR
NT seq 3393 nt   +upstreamnt  +downstreamnt
atgcgttgcctggctccacgccctgctgggtcctacctgtcagagccccaaggcagctca
cagtgtgccaccatggagttggggcccctagaaggtggctacctggagcttcttaacagc
gatgctgaccccctgtgcctctaccacttctatgaccagatggacctggctggagaagaa
gagattgagctctactcagaacccgacacagacaccatcaactgcgaccagttcagcagg
ctgttgtgtgacatggaaggtgatgaagagaccagggaggcttatgccaatatcgcggaa
ctggaccagtatgtcttccaggactcccagctggagggcctgagcaaggacattttcaag
cacataggaccagatgaagtgatcggtgagagtatggagatgccagcagaagttgggcag
aaaagtcagaaaagacccttcccagaggagcttccggcagacctgaagcactggaagcca
gctgagccccccactgtggtgactggcagtctcctagtgggaccagtgagcgactgctcc
accctgccctgcctgccactgcctgcgctgttcaaccaggagccagcctccggccagatg
cgcctggagaaaaccgaccagattcccatgcctttctccagttcctcgttgagctgcctg
aatctccctgagggacccatccagtttgtccccaccatctccactctgccccatgggctc
tggcaaatctctgaggctggaacaggggtctccagtatattcatctaccatggtgaggtg
ccccaggccagccaagtaccccctcccagtggattcactgtccacggcctcccaacatct
ccagaccggccaggctccaccagccccttcgctccatcagccactgacctgcccagcatg
cctgaacctgccctgacctcccgagcaaacatgacagagcacaagacgtcccccacccaa
tgcccggcagctggagaggtctccaacaagcttccaaaatggcctgagccggtggagcag
ttctaccgctcactgcaggacacgtatggtgccgagcccgcaggcccggatggcatccta
gtggaggtggatctggtgcaggccaggctggagaggagcagcagcaagagcctggagcgg
gaactggccaccccggactgggcagaacggcagctggcccaaggaggcctggctgaggtg
ctgttggctgccaaggagcaccggcggccgcgtgagacacgagtgattgctgtgctgggc
aaagctggtcagggcaagagctattgggctggggcagtgagccgggcctgggcttgtggc
cggcttccccagtacgactttgtcttctctgtcccctgccattgcttgaaccgtccgggg
gatgcctatggcctgcaggatctgctcttctccctgggcccacagccactcgtggcggcc
gatgaggttttcagccacatcttgaagagacctgaccgcgttctgctcatcctagacggc
ttcgaggagctggaagcgcaagatggcttcctgcacagcacgtgcggaccggcaccggcg
gagccctgctccctccgggggctgctggccggccttttccagaagaagctgctccgaggt
tgcaccctcctcctcacagcccggccccggggccgcctggtccagagcctgagcaaggcc
gacgccctatttgagctgtccggcttctccatggagcaggcccaggcatacgtgatgcgc
tactttgagagctcagggatgacagagcaccaagacagagccctgacgctcctccgggac
cggccacttcttctcagtcacagccacagccctactttgtgccgggcagtgtgccagctc
tcagaggccctgctggagcttggggaggacgccaagctgccctccacgctcacgggactc
tatgtcggcctgctgggccgtgcagccctcgacagcccccccggggccctggcagagctg
gccaagctggcctgggagctgggccgcagacatcaaagtaccctacaggaggaccagttc
ccatccgcagacgtgaggacctgggcgatggccaaaggcttagtccaacacccaccgcgg
gccgcagagtccgagctggccttccccagcttcctcctgcaatgcttcctgggggccctg
tggctggctctgagtggcgaaatcaaggacaaggagctcccgcagtacctagcattgacc
ccaaggaagaagaggccctatgacaactggctggagggcgtgccacgctttctggctggg
ctgatcttccagcctcccgcccgctgcctgggagccctactcgggccatcggcggctgcc
tcggtggacaggaagcagaaggtgcttgcgaggtacctgaagcggctgcagccggggaca
ctgcgggcgcggcagctgctggagctgctgcactgcgcccacgaggccgaggaggctgga
atttggcagcacgtggtacaggagctccccggccgcctctcttttctgggcacccgcctc
acgcctcctgatgcacatgtactgggcaaggccttggaggcggcgggccaagacttctcc
ctggacctccgcagcactggcatttgcccctctggattggggagcctcgtgggactcagc
tgtgtcacccgtttcagggctgccttgagcgacacggtggcgctgtgggagtccctgcag
cagcatggggagaccaagctacttcaggcagcagaggagaagttcaccatcgagcctttc
aaagccaagtccctgaaggatgtggaagacctgggaaagcttgtgcagactcagaggacg
agaagttcctcggaagacacagctggggagctccctgctgttcgggacctaaagaaactg
gagtttgcgctgggccctgtctcaggcccccaggctttccccaaactggtgcggatcctc
acggccttttcctccctgcagcatctggacctggatgcgctgagtgagaacaagatcggg
gacgagggtgtctcgcagctctcagccaccttcccccagctgaagtccttggaaaccctc
aatctgtcccagaacaacatcactgacctgggtgcctacaaactcgccgaggccctgcct
tcgctcgctgcatccctgctcaggctaagcttgtacaataactgcatctgcgacgtggga
gccgagagcttggctcgtgtgcttccggacatggtgtccctccgggtgatggacgtccag
tacaacaagttcacggctgccggggcccagcagctcgctgccagccttcggaggtgtcct
catgtggagacgctggcgatgtggacgcccaccatcccattcagtgtccaggaacacctg
caacaacaggattcacggatcagcctgagatga

DBGET integrated database retrieval system