KEGG   Homo sapiens (human): 4294
Entry
4294              CDS       T01001                                 

Gene name
MAP3K10, MEKK10, MLK2, MST
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 10
  KO
K04418  mitogen-activated protein kinase kinase kinase 10 [EC:2.7.11.25]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06416  TNF signaling
nt06461  Huntington disease
  Element
N00992  Mutation-caused aberrant Htt to TNF-JNK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    4294 (MAP3K10)
   05022 Pathways of neurodegeneration - multiple diseases
    4294 (MAP3K10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4294 (MAP3K10)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     4294 (MAP3K10)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  MLK family
   4294 (MAP3K10)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH3_9 SH3_1 SH3_2 Pkinase_fungal RNase_Y_N
Other DBs
NCBI-GeneID: 4294
NCBI-ProteinID: NP_002437
OMIM: 600137
HGNC: 6849
Ensembl: ENSG00000130758
Vega: OTTHUMG00000182591
Pharos: Q02779(Tchem)
UniProt: Q02779
LinkDB
Structure
PDB: 
2RF0

Position
19q13.2
AA seq 954 aa
MEEEEGAVAKEWGTTPAGPVWTAVFDYEAAGDEELTLRRGDRVQVLSQDCAVSGDEGWWT
GQLPSGRVGVFPSNYVAPGAPAAPAGLQLPQEIPFHELQLEEIIGVGGFGKVYRALWRGE
EVAVKAARLDPEKDPAVTAEQVCQEARLFGALQHPNIIALRGACLNPPHLCLVMEYARGG
ALSRVLAGRRVPPHVLVNWAVQVARGMNYLHNDAPVPIIHRDLKSINILILEAIENHNLA
DTVLKITDFGLAREWHKTTKMSAAGTYAWMAPEVIRLSLFSKSSDVWSFGVLLWELLTGE
VPYREIDALAVAYGVAMNKLTLPIPSTCPEPFARLLEECWDPDPHGRPDFGSILKRLEVI
EQSALFQMPLESFHSLQEDWKLEIQHMFDDLRTKEKELRSREEELLRAAQEQRFQEEQLR
RREQELAEREMDIVERELHLLMCQLSQEKPRVRKRKGNFKRSRLLKLREGGSHISLPSGF
EHKITVQASPTLDKRKGSDGASPPASPSIIPRLRAIRLTPVDCGGSSSGSSSGGSGTWSR
GGPPKKEELVGGKKKGRTWGPSSTLQKERVGGEERLKGLGEGSKQWSSSAPNLGKSPKHT
PIAPGFASLNEMEEFAEAEDGGSSVPPSPYSTPSYLSVPLPAEPSPGARAPWEPTPSAPP
ARWGHGARRRCDLALLGCATLLGAVGLGADVAEARAADGEEQRRWLDGLFFPRAGRFPRG
LSPPARPHGRREDVGPGLGLAPSATLVSLSSVSDCNSTRSLLRSDSDEAAPAAPSPPPSP
PAPTPTPSPSTNPLVDLELESFKKDPRQSLTPTHVTAACAVSRGHRRTPSDGALGQRGPP
EPAGHGPGPRDLLDFPRLPDPQALFPARRRPPEFPGRPTTLTFAPRPRPAASRPRLDPWK
LVSFGRTLTISPPSRPDTPESPGPPSVQPTLLDMDMEGQNQDSTVPLCGAHGSH
NT seq 2865 nt   +upstreamnt  +downstreamnt
atggaggaggaggagggggcggtggccaaggagtggggcacgacccccgcggggcccgtc
tggaccgcggtgttcgactacgaggcggcgggcgacgaggagctgaccctgcggaggggc
gatcgcgtccaggtgctttcccaagactgtgcggtgtccggcgacgagggctggtggacc
gggcagctccccagcggccgcgtgggcgtcttccccagcaactacgtggcccccggcgcc
cccgctgcacccgcgggcctccagctgccccaggagatccccttccacgagctgcagcta
gaggagatcatcggtgtggggggctttggcaaggtctatcgggccctgtggcgtggcgag
gaggtggcagtcaaggccgcccggctggaccctgagaaggacccggcagtgacagcggag
caggtgtgccaggaagcccggctctttggagccctgcagcaccccaacataattgccctt
aggggcgcctgcctcaaccccccacacctctgcctagtgatggagtatgcccggggtggt
gcactgagcagggtgctggcaggtcgccgggtgccacctcacgtgctggtcaactgggct
gtgcaggtggcccggggcatgaactacctacacaatgatgcccctgtgcccatcatccac
cgggacctcaagtccatcaacatcctgatcctggaggccatcgagaaccacaacctcgca
gacacggtgctcaagatcacggacttcggcctcgcccgcgagtggcacaagaccaccaag
atgagcgctgcggggacctacgcctggatggcgccggaggttatccgtctctccctcttc
tccaaaagcagtgatgtctggagcttcggggtgctgctgtgggagctgctgacgggggag
gtcccctaccgtgagatcgacgccttggccgtggcgtatggcgtggctatgaataagctg
acgctgcccattccctccacgtgccccgagccctttgcccgcctcctggaggaatgctgg
gacccagacccccacgggcggccagatttcggtagcatcttgaagcggcttgaagtcatc
gaacagtcagccctgttccagatgccactggagtccttccactcgctgcaggaagactgg
aagctggagattcagcacatgtttgatgaccttcggaccaaggagaaggagcttcggagc
cgtgaggaggagctgctgcgggcggcacaggagcagcgcttccaggaggagcagctgcgg
cggcgggagcaggagctggcagaacgtgagatggacatcgtggaacgggagctgcacctg
ctcatgtgccagctgagccaggagaagccccgggtccgcaagcgcaagggcaacttcaag
cgcagccgcctgctcaagctgcgggaaggcggcagccacatcagcctgccctctggcttt
gagcataagatcacagtccaggcctctccaactctggataagcggaaaggatccgatggg
gccagcccccctgcaagccccagcatcatcccccggctgagggccattcgcctgactccc
gtggactgtggtggcagcagcagtggcagcagcagtggaggaagtgggacatggagccgc
ggtgggcccccaaagaaggaagaactggtcgggggcaagaagaagggacgaacgtggggg
cccagctccaccctgcagaaggagcgggtgggaggagaggagaggctgaaggggctgggg
gaaggaagcaaacagtggtcatcaagtgcccccaacctgggcaagtcccccaaacacaca
cccatcgcccctggctttgccagcctcaatgagatggaggagttcgcggaggcagaggat
ggaggcagcagcgtgcccccttccccctactcgaccccgtcctacctctcagtgccactg
cctgccgagccctccccgggggcgcgggcgccgtgggagccgacgccgtccgcgcccccc
gctcggtggggacacggcgcccggcggcgctgcgacctggcgctgctaggctgcgccacg
ctgctgggggctgtgggcctgggcgccgacgtggccgaggcgcgcgcggccgacggtgag
gagcagcggcgctggctcgacggcctcttctttccccgcgccggccgcttcccgcggggc
ctcagcccacccgcgcgtccccacggccgccgcgaagacgtgggccccggcctgggcctg
gcgccctcggccaccctcgtgtcgctgtcgtccgtgtccgactgcaactccacgcgttca
ctgctgcgctctgacagtgacgaggccgcaccggccgcgccctccccaccaccctccccg
cccgcgcccacacccacgccctcgcccagcaccaaccccctggtggacctggagctggag
agcttcaagaaggacccccgccagtcgctcacgcccacccacgtcacggctgcatgcgct
gtgagccgcgggcaccggcggacgccatcggacggggcgctggggcagcgggggccgccc
gagcccgcgggccatggccctggccctcgtgaccttctggacttcccccgcctgcccgac
ccccaggccctgttcccagcccgccgccggccccctgagttcccaggccgccccaccacc
ctgacctttgccccgagacctcggccggctgccagtcgcccccgcttggacccctggaaa
ctggtctccttcggccggacactcaccatctcgcctcccagcaggccagacactccggag
agccctgggccccccagcgtgcagcccacactgctggacatggacatggaggggcagaac
caagacagcacagtgcccctgtgcggggcccacggctcccactaa

DBGET integrated database retrieval system