KEGG   Homo sapiens (human): 4299Help
Entry
4299              CDS       T01001                                 

Gene name
AFF1, AF4, MLLT2, PBM1
Definition
(RefSeq) AF4/FMR2 family member 1
  KO
K15184  AF4/FMR2 family member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00119  MLL-AF4 fusion to transcriptional activation
Disease
H00001  B-cell acute lymphoblastic leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    4299 (AFF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    4299 (AFF1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Super elongation complex (SEC)
     4299 (AFF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AF-4
Motif
Other DBs
NCBI-GeneID: 4299
NCBI-ProteinID: NP_005926
OMIM: 159557
HGNC: 7135
Ensembl: ENSG00000172493
Vega: OTTHUMG00000130603
Pharos: P51825(Tbio)
UniProt: P51825 Q14C88
LinkDB All DBs
Position
4q21.3-q22.1
AA seq 1210 aa AA seqDB search
MAAQSSLYNDDRNLLRIREKERRNQEAHQEKEAFPEKIPLFGEPYKTAKGDELSSRIQNM
LGNYEEVKEFLSTKSHTHRLDASENRLGKPKYPLIPDKGSSIPSSSFHTSVHHQSIHTPA
SGPLSVGNISHNPKMAQPRTEPMPSLHAKSCGPPDSQHLTQDRLGQEGFGSSHHKKGDRR
ADGDHCASVTDSAPERELSPLISLPSPVPPLSPIHSNQQTLPRTQGSSKVHGSSNNSKGY
CPAKSPKDLAVKVHDKETPQDSLVAPAQPPSQTFPPPSLPSKSVAMQQKPTAYVRPMDGQ
DQAPSESPELKPLPEDYRQQTFEKTDLKVPAKAKLTKLKMPSQSVEQTYSNEVHCVEEIL
KEMTHSWPPPLTAIHTPSTAEPSKFPFPTKDSQHVSSVTQNQKQYDTSSKTHSNSQQGTS
SMLEDDLQLSDSEDSDSEQTPEKPPSSSAPPSAPQSLPEPVASAHSSSAESESTSDSDSS
SDSESESSSSDSEENEPLETPAPEPEPPTTNKWQLDNWLTKVSQPAAPPEGPRSTEPPRR
HPESKGSSDSATSQEHSESKDPPPKSSSKAPRAPPEAPHPGKRSCQKSPAQQEPPQRQTV
GTKQPKKPVKASARAGSRTSLQGEREPGLLPYGSRDQTSKDKPKVKTKGRPRAAASNEPK
PAVPPSSEKKKHKSSLPAPSKALSGPEPAKDNVEDRTPEHFALVPLTESQGPPHSGSGSR
TSGCRQAVVVQEDSRKDRLPLPLRDTKLLSPLRDTPPPQSLMVKITLDLLSRIPQPPGKG
SRQRKAEDKQPPAGKKHSSEKRSSDSSSKLAKKRKGEAERDCDNKKIRLEKEIKSQSSSS
SSSHKESSKTKPSRPSSQSSKKEMLPPPPVSSSSQKPAKPALKRSRREADTCGQDPPKSA
SSTKSNHKDSSIPKQRRVEGKGSRSSSEHKGSSGDTANPFPVPSLPNGNSKPGKPQVKFD
KQQADLHMREAKKMKQKAELMTDRVGKAFKYLEAVLSFIECGIATESESQSSKSAYSVYS
ETVDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKH
FESSSKVAQAPSPCIASTGTPSPLSPMPSPASSVGSQSSAGSVGSSGVAATISTPVTIQN
MTSSYVTITSHVLTAFDLWEQAEALTRKNKEFFARLSTNVCTLALNSSLVDLVHYTRQGF
QQLQELTKTP
NT seq 3633 nt NT seq  +upstreamnt  +downstreamnt
atggcagcccagtcaagtttgtacaatgacgacagaaacctgcttcgaattagagagaag
gaaagacgcaaccaggaagcccaccaagagaaagaggcatttcctgaaaagattcccctt
tttggagagccctacaagacagcaaaaggtgatgagctgtctagtcgaatacagaacatg
ttgggaaactacgaagaagtgaaggagttccttagtactaagtctcacactcatcgcctg
gatgcttctgaaaataggttgggaaagccgaaatatcctttaattcctgacaaagggagc
agcattccatccagctccttccacactagtgtccaccaccagtccattcacactcctgcg
tctggaccactttctgttggcaacattagccacaatccaaagatggcgcagccaagaact
gaaccaatgccaagtctccatgccaaaagctgcggcccaccggacagccagcacctgacc
caggatcgccttggtcaggaggggttcggctctagtcatcacaagaaaggtgaccgaaga
gctgacggagaccactgtgcttcggtgacagattcggctccagagagggagctttctccc
ttaatctctttgccttccccagttccccctttgtcacctatacattccaaccagcaaact
cttccccggacgcaaggaagcagcaaggttcatggcagcagcaataacagtaaaggctat
tgcccagccaaatctcccaaggacctagcagtgaaagtccatgataaagagacccctcaa
gacagtttggtggcccctgcccagccgccttctcagacatttccacctccctccctcccc
tcaaaaagtgttgcaatgcagcagaagcccacggcttatgtccggcccatggatggtcaa
gatcaggcccctagtgaatcccctgaactgaaaccactgccggaggactatcgacagcag
acctttgaaaaaacagacttgaaagtgcctgccaaagccaagctcaccaaactgaagatg
ccttctcagtcagttgagcagacctactccaatgaagtccattgtgttgaagagattctg
aaggaaatgacccattcatggccgcctcctttgacagcaatacatacgcctagtacagct
gagccatccaagtttcctttccctacaaaggactctcagcatgtcagttctgtaacccaa
aaccaaaaacaatatgatacatcttcaaaaactcactcaaattctcagcaaggaacgtca
tccatgctcgaagacgaccttcagctcagtgacagtgaggacagtgacagtgaacaaacc
ccagagaagcctccctcctcatctgcacctccaagtgctccacagtcccttccagaacca
gtggcatcagcacattccagcagtgcagagtcagaaagcaccagtgactcagacagttcc
tcagactcagagagcgagagcagttcaagtgacagcgaagaaaatgagcccctagaaacc
ccagctccggagcctgagcctccaacaacaaacaaatggcagctggacaactggctgacc
aaagtcagccagccagctgcgccaccagagggccccaggagcacagagcccccacggcgg
cacccagagagtaagggcagcagcgacagtgccacgagtcaggagcattctgaatccaaa
gatcctccccctaaaagctccagcaaagccccccgggccccacccgaagccccccacccc
ggaaagaggagctgtcagaagtctccggcacagcaggagcccccacaaaggcaaaccgtt
ggaaccaaacaacccaaaaaacctgtcaaggcctctgcccgggcaggttcacggaccagc
ctgcagggggaaagggagccagggcttcttccctatggctcccgagaccagacttccaaa
gacaagcccaaggtgaagacgaaaggacggccccgggccgcagcaagcaacgaacccaag
ccagcagtgcccccctccagtgagaagaagaagcacaagagctccctccctgccccctct
aaggctctctcaggcccagaacccgcgaaggacaatgtggaggacaggacccctgagcac
tttgctcttgttcccctgactgagagccagggcccaccccacagtggcagcggcagcagg
actagtggctgccgccaagccgtggtggtccaggaggacagccgcaaagacagactccca
ttgcctttgagagacaccaagctgctctcaccgctcagggacactcctcccccacaaagc
ttgatggtgaagatcaccctagacctgctctctcggataccccagcctcccgggaagggg
agccgccagaggaaagcagaagataaacagccgcccgcagggaagaagcacagctctgag
aagaggagctcagacagctcaagcaagttggccaaaaagagaaagggtgaagcagaaaga
gactgtgataacaagaaaatcagactggagaaggaaatcaaatcacagtcatcttcatct
tcatcctcccacaaagaatcttctaaaacaaagccctccaggccctcctcacagtcctca
aagaaggaaatgctccccccgccacccgtgtcctcgtcctcccagaagccagccaagcct
gcacttaagaggtcaaggcgggaagcagacacctgtggccaggaccctcccaaaagtgcc
agcagtaccaagagcaaccacaaagactcttccattcccaagcagagaagagtagagggg
aagggctccagaagctcctcggagcacaagggttcttccggagatactgcaaatcctttt
ccagtgccttctttgccaaatggtaactctaaaccagggaagcctcaagtgaagtttgac
aaacaacaagcagaccttcacatgagggaggcaaaaaagatgaagcagaaagcagagtta
atgacggacagggttggaaaggcttttaagtacctggaagccgtcttgtccttcattgag
tgcggaattgccacagagtctgaaagccagtcatccaagtcagcttactctgtctactca
gaaactgtagatctcattaaattcataatgtcattaaaatccttctcagatgccacagcg
ccaacacaagagaaaatatttgctgttttatgcatgcgttgccagtccattttgaacatg
gcgatgtttcgttgtaaaaaagacatagcaataaagtattctcgtactcttaataaacac
ttcgagagttcttccaaagtcgcccaggcaccttctccatgcattgcaagcacaggcaca
ccatcccctctttccccaatgccttctcctgccagctccgtagggtcccagtcaagtgct
ggcagtgtggggagcagtggggtggctgccactatcagcaccccagtcaccatccagaat
atgacatcttcctatgtcaccatcacatcccatgttcttaccgcctttgacctttgggaa
caggccgaggccctcacgaggaagaataaagaattctttgctcggctcagcacaaatgtg
tgcaccttggccctcaacagcagtttggtggacctggtgcactatacacgacagggtttt
cagcagctacaagaattaaccaaaacaccttaa

DBGET integrated database retrieval system