KEGG   Homo sapiens (human): 4303Help
Entry
4303              CDS       T01001                                 

Gene name
FOXO4, AFX, AFX1, MLLT7
Definition
(RefSeq) forkhead box O4
  KO
K12358  forkhead box protein O4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    4303 (FOXO4)
   04068 FoxO signaling pathway
    4303 (FOXO4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4303 (FOXO4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Fork head/winged helix other regulators
    4303 (FOXO4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead FOXO-TAD FOXO_KIX_bdg SAND
Motif
Other DBs
NCBI-GeneID: 4303
NCBI-ProteinID: NP_005929
OMIM: 300033
HGNC: 7139
Ensembl: ENSG00000184481
Vega: OTTHUMG00000021789
Pharos: P98177(Tbio)
UniProt: P98177
LinkDB All DBs
Structure
PDB: 

Position
Xq13.1
AA seq 505 aa AA seqDB search
MDPGNENSATEAAAIIDLDPDFEPQSRPRSCTWPLPRPEIANQPSEPPEVEPDLGEKVHT
EGRSEPILLPSRLPEPAGGPQPGILGAVTGPRKGGSRRNAWGNQSYAELISQAIESAPEK
RLTLAQIYEWMVRTVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIKVHNEATGKSSWWML
NPEGGKSGKAPRRRAASMDSSSKLLRGRSKAPKKKPSVLPAPPEGATPTSPVGHFAKWSG
SPCSRNREEADMWTTFRPRSSSNASSVSTRLSPLRPESEVLAEEIPASVSSYAGGVPPTL
NEGLELLDGLNLTSSHSLLSRSGLSGFSLQHPGVTGPLHTYSSSLFSPAEGPLSAGEGCF
SSSQALEALLTSDTPPPPADVLMTQVDPILSQAPTLLLLGGLPSSSKLATGVGLCPKPLE
APGPSSLVPTLSMIAPPPVMASAPIPKALGTPVLTPPTEAASQDRMPQDLDLDMYMENLE
CDMDNIISDLMDEGEGLDFNFEPDP
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggatccggggaatgagaattcagccacagaggctgccgcgatcatagacctagatccc
gacttcgaaccccagagccgtccccgctcctgcacctggccccttccccgaccagagatc
gctaaccagccgtccgagccgcccgaggtggagccagatctgggggaaaaggtacacacg
gaggggcgctcagagccgatcctgttgccctctcggctcccagagccggccgggggcccc
cagcccggaatcctgggggctgtaacaggtcctcggaagggaggctcccgccggaatgcc
tggggaaatcagtcatatgcagaactcatcagccaggccattgaaagcgccccggagaag
cgactgacacttgcccagatctacgagtggatggtccgtactgtaccctacttcaaggac
aagggtgacagcaacagctcagcaggatggaagaactcgatccgccacaacctgtccctg
cacagcaagttcatcaaggttcacaacgaggccaccggcaaaagctcttggtggatgctg
aaccctgagggaggcaagagcggcaaagccccccgccgccgggccgcctccatggatagc
agcagcaagctgctccggggccgcagtaaagcccccaagaagaaaccatctgtgctgcca
gctccacccgaaggtgccactccaacgagccctgtcggccactttgccaagtggtcaggc
agcccttgctctcgaaaccgtgaagaagccgatatgtggaccaccttccgtccacgaagc
agttcaaatgccagcagtgtcagcacccggctgtcccccttgaggccagagtctgaggtg
ctggcggaggaaataccagcttcagtcagcagttatgcagggggtgtccctcccaccctc
aatgaaggtctagagctgttagatgggctcaatctcacctcttcccattccctgctatct
cggagtggtctctctggcttctctttgcagcatcctggggttaccggccccttacacacc
tacagcagctcccttttcagcccagcagaggggcccctgtcagcaggagaagggtgcttc
tccagctcccaggctctggaggccctgctcacctctgatacgccaccaccccctgctgac
gtcctcatgacccaggtagatcccattctgtcccaggctccgactcttctgttgctgggg
gggcttccttcctccagtaagctggccacgggcgtcggcctgtgtcccaagcccctagag
gctccaggccccagcagtctggttcccaccctttctatgatagcaccacctccagtcatg
gcaagtgcccccatccccaaggctctggggactcctgtgctcacaccccctactgaagct
gcaagccaagacagaatgcctcaggatctagatcttgatatgtatatggagaacctggag
tgtgacatggataacatcatcagtgacctcatggatgagggcgagggactggacttcaac
tttgagccagatccctga

DBGET integrated database retrieval system