KEGG   Homo sapiens (human): 4323Help
Entry
4323              CDS       T01001                                 

Gene name
MMP14, MMP-14, MMP-X1, MT-MMP, MT-MMP_1, MT1-MMP, MT1MMP, MTMMP1, WNCHRS
Definition
(RefSeq) matrix metallopeptidase 14
  KO
K07763  matrix metalloproteinase-14 (membrane-inserted) [EC:3.4.24.80]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04668  TNF signaling pathway
hsa04912  GnRH signaling pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
Disease
H02089  Winchester syndrome
Drug target
Prinomastat: D03797
Rebimastat: D03800
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    4323 (MMP14)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    4323 (MMP14)
   04928 Parathyroid hormone synthesis, secretion and action
    4323 (MMP14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    4323 (MMP14)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.80  membrane-type matrix metalloproteinase-1
     4323 (MMP14)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M10
   4323 (MMP14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 Hemopexin DUF3377 PG_binding_1 Astacin Peptidase_M54 Metallopep DUF4953 Reprolysin_3 HTH_17 Peptidase_M66 Reprolysin_5
Motif
Other DBs
NCBI-GeneID: 4323
NCBI-ProteinID: NP_004986
OMIM: 600754
HGNC: 7160
Ensembl: ENSG00000157227
Vega: OTTHUMG00000028704
Pharos: P50281(Tchem)
UniProt: P50281
LinkDB All DBs
Structure
PDB: 

Position
14q11.2
AA seq 582 aa AA seqDB search
MSPAPRPPRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQS
LSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQ
HNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIF
FAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHE
LGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTT
SRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQF
WRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALF
WMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKG
NKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAA
AVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV
NT seq 1749 nt NT seq  +upstreamnt  +downstreamnt
atgtctcccgccccaagacccccccgttgtctcctgctccccctgctcacgctcggcacc
gcgctcgcctccctcggctcggcccaaagcagcagcttcagccccgaagcctggctacag
caatatggctacctgcctcccggggacctacgtacccacacacagcgctcaccccagtca
ctctcagcggccatcgctgccatgcagaagttttacggcttgcaagtaacaggcaaagct
gatgcagacaccatgaaggccatgaggcgcccccgatgtggtgttccagacaagtttggg
gctgagatcaaggccaatgttcgaaggaagcgctacgccatccagggtctcaaatggcaa
cataatgaaatcactttctgcatccagaattacacccccaaggtgggcgagtatgccaca
tacgaggccattcgcaaggcgttccgcgtgtgggagagtgccacaccactgcgcttccgc
gaggtgccctatgcctacatccgtgagggccatgagaagcaggccgacatcatgatcttc
tttgccgagggcttccatggcgacagcacgcccttcgatggtgagggcggcttcctggcc
catgcctacttcccaggccccaacattggaggagacacccactttgactctgccgagcct
tggactgtcaggaatgaggatctgaatggaaatgacatcttcctggtggctgtgcacgag
ctgggccatgccctggggctcgagcattccagtgacccctcggccatcatggcacccttt
taccagtggatggacacggagaattttgtgctgcccgatgatgaccgccggggcatccag
caactttatgggggtgagtcagggttccccaccaagatgccccctcaacccaggactacc
tcccggccttctgttcctgataaacccaaaaaccccacctatgggcccaacatctgtgac
gggaactttgacaccgtggccatgctccgaggggagatgtttgtcttcaaggagcgctgg
ttctggcgggtgaggaataaccaagtgatggatggatacccaatgcccattggccagttc
tggcggggcctgcctgcgtccatcaacactgcctacgagaggaaggatggcaaattcgtc
ttcttcaaaggagacaagcattgggtgtttgatgaggcgtccctggaacctggctacccc
aagcacattaaggagctgggccgagggctgcctaccgacaagattgatgctgctctcttc
tggatgcccaatggaaagacctacttcttccgtggaaacaagtactaccgtttcaacgaa
gagctcagggcagtggatagcgagtaccccaagaacatcaaagtctgggaagggatccct
gagtctcccagagggtcattcatgggcagcgatgaagtcttcacttacttctacaagggg
aacaaatactggaaattcaacaaccagaagctgaaggtagaaccgggctaccccaagtca
gccctgagggactggatgggctgcccatcgggaggccggccggatgaggggactgaggag
gagacggaggtgatcatcattgaggtggacgaggagggcggcggggcggtgagcgcggct
gccgtggtgctgcccgtgctgctgctgctcctggtgctggcggtgggccttgcagtcttc
ttcttcagacgccatgggacccccaggcgactgctctactgccagcgttccctgctggac
aaggtctga

DBGET integrated database retrieval system