KEGG   Homo sapiens (human): 4331
Entry
4331              CDS       T01001                                 

Gene name
MNAT1, CAP35, MAT1, RNF66, TFB3
Definition
(RefSeq) MNAT1 component of CDK activating kinase
  KO
K10842  CDK-activating kinase assembly factor MAT1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03022  Basal transcription factors
hsa03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    4331 (MNAT1)
  09124 Replication and repair
   03420 Nucleotide excision repair
    4331 (MNAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    4331 (MNAT1)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    4331 (MNAT1)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     4331 (MNAT1)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    TFIIH complex
     4331 (MNAT1)
SSDB
Motif
Pfam: MAT1 zf-C3HC4_5 zf-RING_5 zf-RING_UBOX zf-C3HC4 DZR_2 zf-RING_2 zf-C3HC4_2 zf-UDP Prok-RING_4 zinc-ribbons_6 LMBR1 zf-RING_4 zf-P11 DNA_ligase_ZBD Poty_PP zf-C3HC4_4 DUF1272
Other DBs
NCBI-GeneID: 4331
NCBI-ProteinID: NP_002422
OMIM: 602659
HGNC: 7181
Ensembl: ENSG00000020426
Vega: OTTHUMG00000152340
Pharos: P51948(Tbio)
UniProt: P51948 A0A024R688
LinkDB
Structure
PDB: 
6NMI 6O9M 6O9L 1G25

Position
14q23.1
AA seq 309 aa
MDDQGCPRCKTTKYRNPSLKLMVNVCGHTLCESCVDLLFVRGAGNCPECGTPLRKSNFRV
QLFEDPTVDKEVEIRKKVLKIYNKREEDFPSLREYNDFLEEVEEIVFNLTNNVDLDNTKK
KMEIYQKENKDVIQKNKLKLTREQEELEEALEVERQENEQRRLFIQKEEQLQQILKRKNK
QAFLDELESSDLPVALLLAQHKDRSTQLEMQLEKPKPVKPVTFSTGIKMGQHISLAPIHK
LEEALYEYQPLQIETYGPHVPELEMLGRLGYLNHVRAASPQDLAGGYTSSLACHRALQDA
FSGLFWQPS
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgatcagggttgccctcggtgtaagaccaccaaatatcggaacccctccttgaag
ctgatggtgaatgtgtgcggacacactctctgtgaaagttgtgtagatttactgtttgtg
agaggagctggaaactgccctgagtgtggtactccactcagaaagagcaacttcagggta
caactctttgaagatcccactgttgacaaggaggttgagatcaggaaaaaagtgctaaag
atatacaataaaagggaagaagattttcctagtctaagagaatacaatgatttcttggaa
gaagtggaagaaattgttttcaacttgaccaacaatgtggatttggacaacaccaaaaag
aaaatggagatataccaaaaggaaaacaaagatgttattcagaaaaataaattaaagctg
actcgagaacaggaagaactggaagaagctttagaagtggaacgacaggaaaatgaacaa
agaagattatttatacaaaaagaagaacaactgcagcagattctaaaaaggaagaataag
caggcttttttagatgagctggagagttctgatctccctgttgctctgcttttggctcag
cataaagatagatctacccaattagaaatgcaacttgagaaacccaaacctgtaaaacca
gtgacgttttccacaggcatcaaaatgggtcaacatatttcactggcacctattcacaag
cttgaagaagctctgtatgaataccagccactgcagatagagacatatggaccacatgtt
cctgagcttgagatgctaggaagacttgggtatttaaaccatgtcagagctgcctcacca
caggaccttgctggaggctatacttcttctcttgcttgtcacagagcactacaggatgca
ttcagtgggcttttctggcagcccagttaa

DBGET integrated database retrieval system