KEGG   Homo sapiens (human): 434
Entry
434               CDS       T01001                                 

Gene name
ASIP, AGSW, AGTI, AGTIL, ASP, SHEP9
Definition
(RefSeq) agouti signaling protein
  KO
K08725  agouti signaling protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    434 (ASIP)
SSDB
Motif
Pfam: Agouti Toxin_9
Other DBs
NCBI-GeneID: 434
NCBI-ProteinID: NP_001663
OMIM: 600201
HGNC: 745
Ensembl: ENSG00000101440
Vega: OTTHUMG00000032289
Pharos: P42127(Tbio)
UniProt: P42127
LinkDB
Position
20q11.22
AA seq 132 aa
MDVTRLLLATLLVFLCFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSK
QIGRKAAEKKRSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFR
SACSCRVLSLNC
NT seq 399 nt   +upstreamnt  +downstreamnt
atggatgtcacccgcttactcctggccaccctgctggtcttcctctgcttcttcactgcc
aacagccacctgccacctgaggagaagctccgagatgacaggagcctgagaagcaactcc
tctgtgaacctactggatgtcccttctgtctctattgtggcgctgaacaagaaatccaaa
cagatcggcagaaaagcagcagaaaagaaaagatcttctaagaaggaggcttcgatgaag
aaagtggtgcggccccggacccccctatctgcgccctgcgtggccacccgcaacagctgc
aagccgccggcacccgcctgctgcgacccgtgcgcctcctgccagtgccgcttcttccgc
agcgcctgctcctgccgcgtgctcagcctcaactgctga

DBGET integrated database retrieval system