KEGG   Homo sapiens (human): 4352Help
Entry
4352              CDS       T01001                                 

Gene name
MPL, C-MPL, CD110, MPLV, THCYT2, THPOR, TPOR
Definition
(RefSeq) MPL proto-oncogene, thrombopoietin receptor
  KO
K05082  thrombopoietin receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
hsa04630  Jak-STAT signaling pathway
Disease
H00227  Congenital amegakaryocytic thrombocytopenia
H01605  Myelofibrosis
H01612  Essential thrombocytosis
Drug target
Eltrombopag: D03978
Lusutrombopag: D10476
Romiplostim: D08990
Totrombopag choline: D09024
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    4352 (MPL)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    4352 (MPL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:hsa04050]
    4352 (MPL)
   04090 CD molecules [BR:hsa04090]
    4352 (MPL)
Cytokine receptors [BR:hsa04050]
 Interleukin receptor families
  Prolactin receptor family
   4352 (MPL)
CD molecules [BR:hsa04090]
 Proteins
  4352 (MPL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind
Motif
Other DBs
NCBI-GeneID: 4352
NCBI-ProteinID: NP_005364
OMIM: 159530
HGNC: 7217
Ensembl: ENSG00000117400
Vega: OTTHUMG00000007429
Pharos: P40238(Tclin)
UniProt: P40238
LinkDB All DBs
Position
1p34.2
AA seq 635 aa AA seqDB search
MPSWALFMVTSCLLLAPQNLAQVSSQDVSLLASDSEPLKCFSRTFEDLTCFWDEEEAAPS
GTYQLLYAYPREKPRACPLSSQSMPHFGTRYVCQFPDQEEVRLFFPLHLWVKNVFLNQTR
TQRVLFVDSVGLPAPPSIIKAMGGSQPGELQISWEEPAPEISDFLRYELRYGPRDPKNST
GPTVIQLIATETCCPALQRPHSASALDQSPCAQPTMPWQDGPKQTSPSREASALTAEGGS
CLISGLQPGNSYWLQLRSEPDGISLGGSWGSWSLPVTVDLPGDAVALGLQCFTLDLKNVT
CQWQQQDHASSQGFFYHSRARCCPRDRYPIWENCEEEEKTNPGLQTPQFSRCHFKSRNDS
IIHILVEVTTAPGTVHSYLGSPFWIHQAVRLPTPNLHWREISSGHLELEWQHPSSWAAQE
TCYQLRYTGEGHQDWKVLEPPLGARGGTLELRPRSRYRLQLRARLNGPTYQGPWSSWSDP
TRVETATETAWISLVTALHLVLGLSAVLGLLLLRWQFPAHYRRLRHALWPSLPDLHRVLG
QYLRDTAALSPPKATVSDTCEEVEPSLLEILPKSSERTPLPLCSSQAQMDYRRLQPSCLG
TMPLSVCPPMAESGSCCTTHIANHSYLPLSYWQQP
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgccctcctgggccctcttcatggtcacctcctgcctcctcctggcccctcaaaacctg
gcccaagtcagcagccaagatgtctccttgctggcatcagactcagagcccctgaagtgt
ttctcccgaacatttgaggacctcacttgcttctgggatgaggaagaggcagcgcccagt
gggacataccagctgctgtatgcctacccgcgggagaagccccgtgcttgccccctgagt
tcccagagcatgccccactttggaacccgatacgtgtgccagtttccagaccaggaggaa
gtgcgtctcttctttccgctgcacctctgggtgaagaatgtgttcctaaaccagactcgg
actcagcgagtcctctttgtggacagtgtaggcctgccggctccccccagtatcatcaag
gccatgggtgggagccagccaggggaacttcagatcagctgggaggagccagctccagaa
atcagtgatttcctgaggtacgaactccgctatggccccagagatcccaagaactccact
ggtcccacggtcatacagctgattgccacagaaacctgctgccctgctctgcagaggcct
cactcagcctctgctctggaccagtctccatgtgctcagcccacaatgccctggcaagat
ggaccaaagcagacctccccaagtagagaagcttcagctctgacagcagagggtggaagc
tgcctcatctcaggactccagcctggcaactcctactggctgcagctgcgcagcgaacct
gatgggatctccctcggtggctcctggggatcctggtccctccctgtgactgtggacctg
cctggagatgcagtggcacttggactgcaatgctttaccttggacctgaagaatgttacc
tgtcaatggcagcaacaggaccatgctagctcccaaggcttcttctaccacagcagggca
cggtgctgccccagagacaggtaccccatctgggagaactgcgaagaggaagagaaaaca
aatccaggactacagaccccacagttctctcgctgccacttcaagtcacgaaatgacagc
attattcacatccttgtggaggtgaccacagccccgggtactgttcacagctacctgggc
tcccctttctggatccaccaggctgtgcgcctccccaccccaaacttgcactggagggag
atctccagtgggcatctggaattggagtggcagcacccatcgtcctgggcagcccaagag
acctgttatcaactccgatacacaggagaaggccatcaggactggaaggtgctggagccg
cctctcggggcccgaggagggaccctggagctgcgcccgcgatctcgctaccgtttacag
ctgcgcgccaggctcaacggccccacctaccaaggtccctggagctcgtggtcggaccca
actagggtggagaccgccaccgagaccgcctggatctccttggtgaccgctctgcatcta
gtgctgggcctcagcgccgtcctgggcctgctgctgctgaggtggcagtttcctgcacac
tacaggagactgaggcatgccctgtggccctcacttccagacctgcaccgggtcctaggc
cagtaccttagggacactgcagccctgagcccgcccaaggccacagtctcagatacctgt
gaagaagtggaacccagcctccttgaaatcctccccaagtcctcagagaggactcctttg
cccctgtgttcctcccaggcccagatggactaccgaagattgcagccttcttgcctgggg
accatgcccctgtctgtgtgcccacccatggctgagtcagggtcctgctgtaccacccac
attgccaaccattcctacctaccactaagctattggcagcagccttga

DBGET integrated database retrieval system