KEGG   Homo sapiens (human): 4361Help
Entry
4361              CDS       T01001                                 

Gene name
MRE11, ATLD, HNGS1, MRE11A, MRE11B
Definition
(RefSeq) MRE11 homolog, double strand break repair nuclease
  KO
K10865  double-strand break repair protein MRE11
Organism
hsa  Homo sapiens (human)
Pathway
hsa03440  Homologous recombination
hsa03450  Non-homologous end-joining
hsa04218  Cellular senescence
Disease
H00094  Immunodeficiency associated with DNA repair defects
H02014  Ataxia-telangiectasia-like syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    4361 (MRE11)
   03450 Non-homologous end-joining
    4361 (MRE11)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    4361 (MRE11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    4361 (MRE11)
   03400 DNA repair and recombination proteins [BR:hsa03400]
    4361 (MRE11)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    MRN complex
     4361 (MRE11)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     4361 (MRE11)
    BRCA1-C complex
     4361 (MRE11)
   NHEJ (non-homologous end-joining)
    MRX complex
     4361 (MRE11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mre11_DNA_bind Metallophos Metallophos_2
Motif
Other DBs
NCBI-GeneID: 4361
NCBI-ProteinID: NP_005582
OMIM: 600814
HGNC: 7230
Ensembl: ENSG00000020922
Vega: OTTHUMG00000167780
Pharos: P49959(Tbio)
UniProt: P49959 A0A024R395
LinkDB All DBs
Structure
PDB: 

Position
11q21
AA seq 708 aa AA seqDB search
MSTADALDDENTFKILVATDIHLGFMEKDAVRGNDTFVTLDEILRLAQENEVDFILLGGD
LFHENKPSRKTLHTCLELLRKYCMGDRPVQFEILSDQSVNFGFSKFPWVNYQDGNLNISI
PVFSIHGNHDDPTGADALCALDILSCAGFVNHFGRSMSVEKIDISPVLLQKGSTKIALYG
LGSIPDERLYRMFVNKKVTMLRPKEDENSWFNLFVIHQNRSKHGSTNFIPEQFLDDFIDL
VIWGHEHECKIAPTKNEQQLFYISQPGSSVVTSLSPGEAVKKHVGLLRIKGRKMNMHKIP
LHTVRQFFMEDIVLANHPDIFNPDNPKVTQAIQSFCLEKIEEMLENAERERLGNSHQPEK
PLVRLRVDYSGGFEPFSVLRFSQKFVDRVANPKDIIHFFRHREQKEKTGEEINFGKLITK
PSEGTTLRVEDLVKQYFQTAEKNVQLSLLTERGMGEAVQEFVDKEEKDAIEELVKYQLEK
TQRFLKERHIDALEDKIDEEVRRFRETRQKNTNEEDDEVREAMTRARALRSQSEESASAF
SADDLMSIDLAEQMANDSDDSISAATNKGRGRGRGRRGGRGQNSASRGGSQRGRADTGLE
TSTRSRNSKTAVSASRNMSIIDAFKSTRQQPSRNVTTKNYSEVIEVDESDVEEDIFPTTS
KTDQRWSSTSSSKIMSQSQVSKGVDFESSEDDDDDPFMNTSSLRRNRR
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgagtactgcagatgcacttgatgatgaaaacacatttaaaatattagttgcaacagat
attcatcttggatttatggagaaagatgcagtcagaggaaatgatacgtttgtaacactc
gatgaaattttaagacttgcccaggaaaatgaagtggattttattttgttaggtggtgat
ctttttcatgaaaataagccctcaaggaaaacattacatacctgcctcgagttattaaga
aaatattgtatgggtgatcggcctgtccagtttgaaattctcagtgatcagtcagtcaac
tttggttttagtaagtttccatgggtgaactatcaagatggcaacctcaacatttcaatt
ccagtgtttagtattcatggcaatcatgacgatcccacaggggcagatgcactttgtgcc
ttggacattttaagttgtgctggatttgtaaatcactttggacgttcaatgtctgtggag
aagatagacattagtccggttttgcttcaaaaaggaagcacaaagattgcgctatatggt
ttaggatccattccagatgaaaggctctatcgaatgtttgtcaataaaaaagtaacaatg
ttgagaccaaaggaagatgagaactcttggtttaacttatttgtgattcatcagaacagg
agtaaacatggaagtactaacttcattccagaacaatttttggatgacttcattgatctt
gttatctggggccatgaacatgagtgtaaaatagctccaaccaaaaatgaacaacagctg
ttttatatctcacaacctggaagctcagtggttacttctctttccccaggagaagctgta
aagaaacatgttggtttgctgcgtattaaagggaggaagatgaatatgcataaaattcct
cttcacacagtgcggcagtttttcatggaggatattgttctagctaatcatccagacatt
tttaacccagataatcctaaagtaacccaagccatacaaagcttctgtttggagaagatt
gaagaaatgcttgaaaatgctgaacgggaacgtctgggtaattctcaccagccagagaag
cctcttgtacgactgcgagtggactatagtggaggttttgaacctttcagtgttcttcgc
tttagccagaaatttgtggatcgggtagctaatccaaaagacattatccattttttcagg
catagagaacaaaaggaaaaaacaggagaagagatcaactttgggaaacttatcacaaag
ccttcagaaggaacaactttaagggtagaagatcttgtaaaacagtactttcaaaccgca
gagaagaatgtgcagctctcactgctaacagaaagagggatgggtgaagcagtacaagaa
tttgtggacaaggaggagaaagatgccattgaggaattagtgaaataccagttggaaaaa
acacagcgatttcttaaagaacgtcatattgatgccctcgaagacaaaatcgatgaggag
gtacgtcgtttcagagaaaccagacaaaaaaatactaatgaagaagatgatgaagtccgt
gaggctatgaccagggccagagcactcagatctcagtcagaggagtctgcttctgccttt
agtgctgatgaccttatgagtatagatttagcagaacagatggctaatgactctgatgat
agcatctcagcagcaaccaacaaaggaagaggccgaggaagaggtcgaagaggtggaaga
gggcagaattcagcatcgagaggagggtctcaaagaggaagagcagacactggtctggag
acttctacccgtagcaggaactcaaagactgctgtgtcagcatctagaaatatgtctatt
atagatgcctttaaatctacaagacagcagccttcccgaaatgtcactactaagaattat
tcagaggtgattgaggtagatgaatcagatgtggaagaagacatttttcctaccacttca
aagacagatcaaaggtggtccagcacatcatccagcaaaatcatgtcccagagtcaagta
tcgaaaggggttgattttgaatcaagtgaggatgatgatgatgatccttttatgaacact
agttctttaagaagaaatagaagataa

DBGET integrated database retrieval system