KEGG   Homo sapiens (human): 445
Entry
445               CDS       T01001                                 

Gene name
ASS1, ASS, CTLN1
Definition
(RefSeq) argininosuccinate synthase 1
  KO
K01940  argininosuccinate synthase [EC:6.3.4.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00220  Arginine biosynthesis
hsa00250  Alanine, aspartate and glutamate metabolism
hsa01100  Metabolic pathways
hsa01230  Biosynthesis of amino acids
hsa05418  Fluid shear stress and atherosclerosis
Module
hsa_M00029  Urea cycle
hsa_M00844  Arginine biosynthesis, ornithine => arginine
Network
nt06010  Urea cycle
  Element
N00593  Urea cycle
N00594  ARG1 deficiency in urea cycle
N00595  ASL deficiency in urea cycle
N00596  ASS deficiency in urea cycle
Disease
H00185  Citrullinemia
H01398  Primary hyperammonemic disorders (Urea cycle disorders)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    445 (ASS1)
   00220 Arginine biosynthesis
    445 (ASS1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    445 (ASS1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    445 (ASS1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.5  argininosuccinate synthase
     445 (ASS1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   445 (ASS1)
SSDB
Motif
Pfam: Arginosuc_synth QueC tRNA_Me_trans
Other DBs
NCBI-GeneID: 445
NCBI-ProteinID: NP_000041
OMIM: 603470
HGNC: 758
Ensembl: ENSG00000130707
Vega: OTTHUMG00000020806
Pharos: P00966(Tbio)
UniProt: P00966 Q5T6L4
LinkDB
Structure
PDB: 
2NZ2

Position
9q34.11
AA seq 412 aa
MSSKGSVVLAYSGGLDTSCILVWLKEQGYDVIAYLANIGQKEDFEEARKKALKLGAKKVF
IEDVSREFVEEFIWPAIQSSALYEDRYLLGTSLARPCIARKQVEIAQREGAKYVSHGATG
KGNDQVRFELSCYSLAPQIKVIAPWRMPEFYNRFKGRNDLMEYAKQHGIPIPVTPKNPWS
MDENLMHISYEAGILENPKNQAPPGLYTKTQDPAKAPNTPDILEIEFKKGVPVKVTNVKD
GTTHQTSLELFMYLNEVAGKHGVGRIDIVENRFIGMKSRGIYETPAGTILYHAHLDIEAF
TMDREVRKIKQGLGLKFAELVYTGFWHSPECEFVRHCIAKSQERVEGKVQVSVLKGQVYI
LGRESPLSLYNEELVSMNVQGDYEPTDATGFININSLRLKEYHRLQSKVTAK
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgtccagcaaaggctccgtggttctggcctacagtggcggcctggacacctcgtgcatc
ctcgtgtggctgaaggaacaaggctatgacgtcattgcctatctggccaacattggccag
aaggaagacttcgaggaagccaggaagaaggcactgaagcttggggccaaaaaggtgttc
attgaggatgtcagcagggagtttgtggaggagttcatctggccggccatccagtccagc
gcactgtatgaggaccgctacctcctgggcacctctcttgccaggccctgcatcgcccgc
aaacaagtggaaatcgcccagcgggagggggccaagtatgtgtcccacggcgccacagga
aaggggaacgatcaggtccggtttgagctcagctgctactcactggccccccagataaag
gtcattgctccctggaggatgcctgaattctacaaccggttcaagggccgcaatgacctg
atggagtacgcaaagcaacacgggattcccatcccggtcactcccaagaacccgtggagc
atggatgagaacctcatgcacatcagctacgaggctggaatcctggagaaccccaagaac
caagcgcctccaggtctctacacgaagacccaggacccagccaaagcccccaacacccct
gacattctcgagatcgagttcaaaaaaggggtccctgtgaaggtgaccaacgtcaaggat
ggcaccacccaccagacctccttggagctcttcatgtacctgaacgaagtcgcgggcaag
catggcgtgggccgtattgacatcgtggagaaccgcttcattggaatgaagtcccgaggt
atctacgagaccccagcaggcaccatcctttaccatgctcatttagacatcgaggccttc
accatggaccgggaagtgcgcaaaatcaaacaaggcctgggcttgaaatttgctgagctg
gtgtataccggtttctggcacagccctgagtgtgaatttgtccgccactgcatcgccaag
tcccaggagcgagtggaagggaaagtgcaggtgtccgtcctcaagggccaggtgtacatc
ctcggccgggagtccccactgtctctctacaatgaggagctggtgagcatgaacgtgcag
ggtgattatgagccaactgatgccaccgggttcatcaacatcaattccctcaggctgaag
gaatatcatcgtctccagagcaaggtcactgccaaatag

DBGET integrated database retrieval system