KEGG   Homo sapiens (human): 4478
Entry
4478              CDS       T01001                                 

Gene name
MSN, HEL70, IMD50
Definition
(RefSeq) moesin
  KO
K05763  moesin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05162  Measles
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    4478 (MSN)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    4478 (MSN)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    4478 (MSN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    4478 (MSN)
  09172 Infectious disease: viral
   05162 Measles
    4478 (MSN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4478 (MSN)
   04147 Exosome [BR:hsa04147]
    4478 (MSN)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Gelsolin / villin
     4478 (MSN)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   4478 (MSN)
SSDB
Motif
Pfam: ERM FERM_C FERM_M FERM_N
Other DBs
NCBI-GeneID: 4478
NCBI-ProteinID: NP_002435
OMIM: 309845
HGNC: 7373
Ensembl: ENSG00000147065
Vega: OTTHUMG00000021723
Pharos: P26038(Tbio)
UniProt: P26038 V9HWC0
LinkDB
Structure
PDB: 
1EF1 1SGH 1E5W

Position
Xq12
AA seq 577 aa
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLK
LNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE
TAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHR
GMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMERLKQIEEQTKK
AQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALE
MAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQ
DEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTA
NDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgcccaaaacgatcagtgtgcgtgtgaccaccatggatgcagagctggagtttgccatc
cagcccaacaccaccgggaagcagctatttgaccaggtggtgaaaactattggcttgagg
gaagtttggttctttggtctgcagtaccaggacactaaaggtttctccacctggctgaaa
ctcaataagaaggtgactgcccaggatgtgcggaaggaaagccccctgctctttaagttc
cgtgccaagttctaccctgaggatgtgtccgaggaattgattcaggacatcactcagcgc
ctgttctttctgcaagtgaaagagggcattctcaatgatgatatttactgcccgcctgag
accgctgtgctgctggcctcgtatgctgtccagtctaagtatggcgacttcaataaggaa
gtgcataagtctggctacctggccggagacaagttgctcccgcagagagtcctggaacag
cacaaactcaacaaggaccagtgggaggagcggatccaggtgtggcatgaggaacaccgt
ggcatgctcagggaggatgctgtcctggaatatctgaagattgctcaagatctggagatg
tatggtgtgaactacttcagcatcaagaacaagaaaggctcagagctgtggctgggggtg
gatgccctgggtctcaacatctatgagcagaatgacagactaactcccaagataggcttc
ccctggagtgaaatcaggaacatctctttcaatgataagaaatttgtcatcaagcccatt
gacaaaaaagccccggacttcgtcttctatgctccccggctgcggattaacaagcggatc
ttggccttgtgcatggggaaccatgaactatacatgcgccgtcgcaagcctgataccatt
gaggtgcagcagatgaaggcacaggcccgggaggagaagcaccagaagcagatggagcgt
gctatgctggaaaatgagaagaagaagcgtgaaatggcagagaaggagaaagagaagatt
gaacgggagaaggaggagctgatggagaggctgaagcagatcgaggaacagactaagaag
gctcagcaagaactggaagaacagacccgtagggctctggaacttgagcaggaacggaag
cgtgcccagagcgaggctgaaaagctggccaaggagcgtcaagaagctgaagaggccaag
gaggccttgctgcaggcctcccgggaccagaaaaagactcaggaacagctggccttggaa
atggcagagctgacagctcgaatctcccagctggagatggcccgacagaagaaggagagt
gaggctgtggagtggcagcagaaggcccagatggtacaggaagacttggagaagacccgt
gctgagctgaagactgccatgagtacacctcatgtggcagagcctgctgagaatgagcag
gatgagcaggatgagaatggggcagaggctagtgctgacctacgggctgatgctatggcc
aaggaccgcagtgaggaggaacgtaccactgaggcagagaagaatgagcgtgtgcagaag
cacctgaaggccctcacttcggagctggccaatgccagagatgagtccaagaagactgcc
aatgacatgatccatgctgagaacatgcgactgggccgagacaaatacaagaccctgcgc
cagatccggcagggcaacaccaagcagcgcattgacgaatttgagtctatgtaa

KEGG   Homo sapiens (human): 5962
Entry
5962              CDS       T01001                                 

Gene name
RDX, DFNB24
Definition
(RefSeq) radixin
  KO
K05762  radixin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa04810  Regulation of actin cytoskeleton
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
Disease
H00605  Deafness, autosomal recessive
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    5962 (RDX)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5962 (RDX)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    5962 (RDX)
   05205 Proteoglycans in cancer
    5962 (RDX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    5962 (RDX)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   5962 (RDX)
SSDB
Motif
Pfam: ERM FERM_C FERM_M FERM_N
Other DBs
NCBI-GeneID: 5962
NCBI-ProteinID: NP_002897
OMIM: 179410
HGNC: 9944
Ensembl: ENSG00000137710
Vega: OTTHUMG00000166574
Pharos: P35241(Tbio)
UniProt: P35241 B0YJ88 Q6PKD3
LinkDB
Position
11q22.3
AA seq 583 aa
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTVGLREVWFFGLQYVDSKGYSTWLK
LNKKVTQQDVKKENPLQFKFRAKFFPEDVSEELIQEITQRLFFLQVKEAILNDEIYCPPE
TAVLLASYAVQAKYGDYNKEIHKPGYLANDRLLPQRVLEQHKLTKEQWEERIQNWHEEHR
GMLREDSMMEYLKIAQDLEMYGVNYFEIKNKKGTELWLGVDALGLNIYEHDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERAQLENEKKKREIAEKEKERIEREKEELMERLKQIEEQTIK
AQKELEEQTRKALELDQERKRAKEEAERLEKERRAAEEAKSAIAKQAADQMKNQEQLAAE
LAEFTAKIALLEEAKKKKEEEATEWQHKAFAAQEDLEKTKEELKTVMSAPPPPPPPPVIP
PTENEHDEHDENNAEASAELSNEGVMNHRSEEERVTETQKNERVKKQLQALSSELAQARD
ETKKTQNDVLHAENVKAGRDKYKTLRQIRQGNTKQRIDEFEAM
NT seq 1752 nt   +upstreamnt  +downstreamnt
atgccgaaaccaatcaacgtaagagtaactacaatggatgctgagctggaatttgccatt
cagcccaatacaactggcaaacaactttttgaccaggtggtgaaaacagttggtttgcgt
gaggtctggttttttgggctgcagtatgtagacagcaaaggttattctacatggcttaaa
ctaaataaaaaggtaacacagcaggatgttaaaaaagagaatcctttacagttcaagttt
agagctaaattctttcctgaagatgtttctgaggaattaattcaagaaataacccagaga
ctcttcttcttgcaagttaaagaagccatcttaaatgatgagatatattgcccgccagaa
actgcagttcttttggcttcctatgctgtccaagccaagtatggagattacaataaagag
attcataagccaggctacctggctaatgatagactcctaccccagcgtgtattggaacaa
cacaaactaacaaaagaacagtgggaagaaagaatacagaactggcatgaagaacataga
ggaatgttaagggaggattctatgatggaatacctgaagattgcacaagatctagaaatg
tatggagtcaactattttgaaataaaaaataaaaaaggaactgaattgtggctaggtgtt
gatgctttgggtctgaatatttatgagcatgacgacaagttaacacctaaaattggtttt
ccctggagtgaaatcagaaatatttcatttaatgacaaaaaatttgttataaagccaatc
gacaaaaaggcacctgattttgtgttttatgcacctcgtctgagaatcaataagcggatt
ttggccttatgtatgggaaaccatgaactatacatgcgaagaaggaagcctgatactatt
gaagtacaacagatgaaggctcaggctagggaggagaaacatcagaagcagttggaaagg
gcacaattagagaatgaaaagaagaaaagagaaatagcagaaaaggaaaaggaaagaata
gaacgtgaaaaggaagagctaatggaacgtctaaaacaaattgaagagcagacaattaaa
gctcagaaagaactagaagaacagactcgaaaagctctagaactggatcaagaacgaaaa
cgagcaaaagaagaagcagaacgacttgaaaaggagcgtcgagctgctgaagaggcaaag
tctgccatagcaaaacaagctgccgaccagatgaagaatcaggagcagctagcagcagaa
cttgctgaattcactgccaagattgcacttctagaggaagccaagaagaaaaaggaagag
gaagctactgagtggcaacacaaagcttttgcagcccaggaagacttggaaaagaccaaa
gaagagttaaaaactgtgatgtctgccccccctccacctccaccaccaccagtcattcct
ccaacagaaaacgaacatgatgaacacgatgagaataatgctgaagctagtgctgaatta
tcaaatgaaggggtaatgaaccatagaagcgaggaagaacgtgtaaccgaaacacagaaa
aatgagcgtgttaagaagcaacttcaggcattaagttcagaattagcccaagccagagat
gaaaccaagaaaacacaaaatgatgttcttcatgctgagaatgttaaagcaggccgtgat
aagtacaagactctgcgacagattcgacaaggcaatacaaagcagcgtatcgatgagttt
gaagcaatgtga

KEGG   Homo sapiens (human): 7430
Entry
7430              CDS       T01001                                 

Gene name
EZR, CVIL, CVL, HEL-S-105, VIL2
Definition
(RefSeq) ezrin
  KO
K08007  villin 2 (ezrin)
Organism
hsa  Homo sapiens (human)
Pathway
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa04971  Gastric acid secretion
hsa05130  Pathogenic Escherichia coli infection
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
Network
nt06135  Cytoskeletal regulation (viruses)
  Element
N01095  Escherichia Map to LPA-GNA12/13-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    7430 (EZR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    7430 (EZR)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    7430 (EZR)
  09154 Digestive system
   04971 Gastric acid secretion
    7430 (EZR)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    7430 (EZR)
   05205 Proteoglycans in cancer
    7430 (EZR)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    7430 (EZR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7430 (EZR)
   04147 Exosome [BR:hsa04147]
    7430 (EZR)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Gelsolin / villin
     7430 (EZR)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7430 (EZR)
SSDB
Motif
Pfam: ERM FERM_C FERM_M FERM_N
Other DBs
NCBI-GeneID: 7430
NCBI-ProteinID: NP_001104547
OMIM: 123900
HGNC: 12691
Ensembl: ENSG00000092820
Vega: OTTHUMG00000015917
Pharos: P15311(Tbio)
UniProt: P15311
LinkDB
Structure
PDB: 
4RMA 4RM8 4RM9 1NI2

Position
6q25.3
AA seq 586 aa
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLHYVDNKGFPTWLK
LDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR
GMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKK
AERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgccgaaaccaatcaatgtccgagttaccaccatggatgcagagctggagtttgcaatc
cagccaaatacaactggaaaacagctttttgatcaggtggtaaagactatcggcctccgg
gaagtgtggtactttggcctccactatgtggataataaaggatttcctacctggctgaag
ctggataagaaggtgtctgcccaggaggtcaggaaggagaatcccctccagttcaagttc
cgggccaagttctaccctgaagatgtggctgaggagctcatccaggacatcacccagaaa
cttttcttcctccaagtgaaggaaggaatccttagcgatgagatctactgcccccctgag
actgccgtgctcttggggtcctacgctgtgcaggccaagtttggggactacaacaaagaa
gtgcacaagtctgggtacctcagctctgagcggctgatccctcaaagagtgatggaccag
cacaaacttaccagggaccagtgggaggaccggatccaggtgtggcatgcggaacaccgt
gggatgctcaaagataatgctatgttggaatacctgaagattgctcaggacctggaaatg
tatggaatcaactatttcgagataaaaaacaagaaaggaacagacctttggcttggagtt
gatgcccttggactgaatatttatgagaaagatgataagttaaccccaaagattggcttt
ccttggagtgaaatcaggaacatctctttcaatgacaaaaagtttgtcattaaacccatc
gacaagaaggcacctgactttgtgttttatgccccacgtctgagaatcaacaagcggatc
ctgcagctctgcatgggcaaccatgagttgtatatgcgccgcaggaagcctgacaccatc
gaggtgcagcagatgaaggcccaggcccgggaggagaagcatcagaagcagctggagcgg
caacagctggaaacagagaagaaaaggagagaaaccgtggagagagagaaagagcagatg
atgcgcgagaaggaggagttgatgctgcggctgcaggactatgaggagaagacaaagaag
gcagagagagagctctcggagcagattcagagggccctgcagctggaggaggagaggaag
cgggcacaggaggaggccgagcgcctagaggctgaccgtatggctgcactgcgggctaag
gaggagctggagagacaggcggtggatcagataaagagccaggagcagctggctgcggag
cttgcagaatacactgccaagattgccctcctggaagaggcgcggaggcgcaaggaggat
gaagttgaagagtggcagcacagggccaaagaagcccaggatgacctggtgaagaccaag
gaggagctgcacctggtgatgacagcacccccgcccccaccaccccccgtgtacgagccg
gtgagctaccatgtccaggagagcttgcaggatgagggcgcagagcccacgggctacagc
gcggagctgtctagtgagggcatccgggatgaccgcaatgaggagaagcgcatcactgag
gcagagaagaacgagcgtgtgcagcggcagctgctgacgctgagcagcgagctgtcccag
gcccgagatgagaataagaggacccacaatgacatcatccacaacgagaacatgaggcaa
ggccgggacaagtacaagacgctgcggcagatccggcagggcaacaccaagcagcgcatc
gacgagttcgaggccctgtaa

DBGET integrated database retrieval system