KEGG   Homo sapiens (human): 4487Help
Entry
4487              CDS       T01001                                 

Gene name
MSX1, ECTD3, HOX7, HYD1, STHAG1
Definition
(RefSeq) msh homeobox 1
  KO
K09341  homeobox protein MSX
Organism
hsa  Homo sapiens (human)
Pathway
hsa05166  Human T-cell leukemia virus 1 infection
Disease
H00516  Cleft lip and/or cleft palate
H00625  Tooth agenesis
H00643  Tooth and nail syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4487 (MSX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4487 (MSX1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Msh
    4487 (MSX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain
Motif
Other DBs
NCBI-GeneID: 4487
NCBI-ProteinID: NP_002439
OMIM: 142983
HGNC: 7391
Ensembl: ENSG00000163132
Vega: OTTHUMG00000090335
Pharos: P28360(Tbio)
UniProt: P28360
LinkDB All DBs
Position
4p16.2
AA seq 303 aa AA seqDB search
MAPAADMTSLPLGVKVEDSAFGKPAGGGAGQAPSAAAATAAAMGADEEGAKPKVSPSLLP
FSVEALMADHRKPGAKESALAPSEGVQAAGGSAQPLGVPPGSLGAPDAPSSPRPLGHFSV
GGLLKLPEDALVKAESPEKPERTPWMQSPRFSPPPARRLSPPACTLRKHKTNRKPRTPFT
TAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQNRRAKAKRLQEAELEKLKM
AAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMY
HLT
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggccccggctgctgacatgacttctttgccactcggtgtcaaagtggaggactccgcc
ttcggcaagccggcggggggaggcgcgggccaggcccccagcgccgccgcggccacggca
gccgccatgggcgcggacgaggagggggccaagcccaaagtgtccccttcgctcctgccc
ttcagcgtggaggcgctcatggccgaccacaggaagccgggggccaaggagagcgccctg
gcgccctccgagggcgtgcaggcggcgggtggctcggcgcagccactgggcgtcccgccg
gggtcgctgggagccccggacgcgccctcttcgccgcggccgctcggccatttctcggtg
gggggactcctcaagctgccagaagatgcgctcgtcaaagccgagagccccgagaagccc
gagaggaccccgtggatgcagagcccccgcttctccccgccgccggccaggcggctgagc
cccccagcctgcaccctccgcaaacacaagacgaaccgtaagccgcggacgcccttcacc
accgcgcagctgctggcgctggagcgcaagttccgccagaagcagtacctgtccatcgcc
gagcgcgcggagttctccagctcgctcagcctcactgagacgcaggtgaagatatggttc
cagaaccgccgcgccaaggcaaagagactacaagaggcagagctggagaagctgaagatg
gccgccaagcccatgctgccaccggctgccttcggcctctccttccctctcggcggcccc
gcagctgtagcggccgcggcgggtgcctcgctctacggtgcctctggccccttccagcgc
gccgcgctgcctgtggcgcccgtgggactctacacggcccatgtgggctacagcatgtac
cacctgacatag

KEGG   Homo sapiens (human): 4488Help
Entry
4488              CDS       T01001                                 

Gene name
MSX2, CRS2, FPP, HOX8, MSH, PFM, PFM1
Definition
(RefSeq) msh homeobox 2
  KO
K09341  homeobox protein MSX
Organism
hsa  Homo sapiens (human)
Pathway
hsa05166  Human T-cell leukemia virus 1 infection
Disease
H00475  Enlarged parietal foramina/cranium bifidum
H02160  Craniosynostoses
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4488 (MSX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4488 (MSX2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Homeo domain only, Msh
    4488 (MSX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Homeodomain Homeobox_KN
Motif
Other DBs
NCBI-GeneID: 4488
NCBI-ProteinID: NP_002440
OMIM: 123101
HGNC: 7392
Ensembl: ENSG00000120149
Vega: OTTHUMG00000130556
Pharos: P35548(Tbio)
UniProt: P35548
LinkDB All DBs
Position
5q35.2
AA seq 267 aa AA seqDB search
MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVEALMSDKKPPK
EASPLPAESASAGATLRPLLLSGHGAREAHSPGPLVKPFETASVKSENSEDGAAWMQEPG
RYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLN
LTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSSFSLPFPISSPLQAASIYGASY
PFHRPVLPIPPVGLYATPVGYGMYHLS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcttctccgtccaaaggcaatgacttgttttcgcccgacgaggagggcccagcagtg
gtggccggaccaggcccggggcctgggggcgccgagggggccgcggaggagcgccgcgtc
aaggtctccagcctgcccttcagcgtggaggcgctcatgtccgacaagaagccgcccaag
gaggcgtccccgctgccggccgaaagcgcctcggccggggccaccctgcggccactgctg
ctgtcggggcacggcgctcgggaagcgcacagccccgggccgctggtgaagcccttcgag
accgcctcggtcaagtcggaaaattcagaagatggagcggcgtggatgcaggaacccggc
cgatattcgccgccgccaagacatatgagccctaccacctgcaccctgaggaaacacaag
accaatcggaagccgcgcacgccctttaccacatcccagctcctcgccctggagcgcaag
ttccgtcagaaacagtacctctccattgcagagcgtgcagagttctccagctctctgaac
ctcacagagacccaggtcaaaatctggttccagaaccgaagggccaaggcgaaaagactg
caggaggcagaactggaaaagctgaaaatggctgcaaaacctatgctgccctccagcttc
agtctccctttccccatcagctcgcccctgcaggcagcgtccatatatggagcatcctac
ccgttccatagacctgtgcttcccatcccgcctgtgggactctatgccacgccagtggga
tatggcatgtaccacctgtcctaa

DBGET integrated database retrieval system