KEGG   Homo sapiens (human): 4515
Entry
4515              CDS       T01001                                 

Gene name
MTCP1, P13MTCP1, TCL1C, p8MTCP1
Definition
(RefSeq) mature T cell proliferation 1
  KO
K16837  mature T-cell proliferation-1 type B1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    4515 (MTCP1)
SSDB
Motif
Pfam: TCL1_MTCP1
Other DBs
NCBI-GeneID: 4515
NCBI-ProteinID: NP_001018025
OMIM: 300116
HGNC: 7423
Ensembl: ENSG00000214827
Vega: OTTHUMG00000156241
Pharos: P56278(Tdark)
UniProt: P56278
LinkDB
Structure
PDB: 
1A1X 1QTT 1QTU

Position
Xq28
AA seq 107 aa
MAGEDVGAPPDHLWVHQEGIYRDEYQRTWVAVVEEETSFLRARVQQIQVPLGDAARPSHL
LTSQLPLMWQLYPEERYMDNNSRLWQIQHHLMVRGVQELLLKLLPDD
NT seq 324 nt   +upstreamnt  +downstreamnt
atggcaggagaggatgtgggggctccacccgatcacctctgggttcaccaagagggtatc
taccgcgacgaataccagcgcacgtgggtggccgtcgtggaagaggagacgagtttccta
agggcacgagtccagcaaattcaggttcccttaggtgacgcagctaggccaagtcacctt
cttacctcccagctacctctcatgtggcaactctacccggaggagcgctacatggataac
aactctcgcttgtggcagatacagcatcatttaatggtcaggggagtacaggagctgttg
cttaagcttttgcctgatgactaa

KEGG   Homo sapiens (human): 8115
Entry
8115              CDS       T01001                                 

Gene name
TCL1A, TCL1
Definition
(RefSeq) TCL1 family AKT coactivator A
  KO
K10167  T-cell leukemia/lymphoma 1A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    8115 (TCL1A)
SSDB
Motif
Pfam: TCL1_MTCP1
Other DBs
NCBI-GeneID: 8115
NCBI-ProteinID: NP_001092195
OMIM: 186960
HGNC: 11648
Ensembl: ENSG00000100721
Vega: OTTHUMG00000171390
Pharos: P56279(Tbio)
UniProt: P56279 A0A024R6G5
LinkDB
Structure
PDB: 
1JSG

Position
14q32.13
AA seq 114 aa
MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGR
PMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD
NT seq 345 nt   +upstreamnt  +downstreamnt
atggccgagtgcccgacactcggggaggcagtcaccgaccacccggaccgcctgtgggcc
tgggagaagttcgtgtatttggacgagaagcagcacgcctggctgcccttaaccatcgag
ataaaggataggttacagttacgggtgctcttgcgtcgggaagacgtcgtcctggggagg
cctatgacccccacccagataggcccaagcctgctgcctatcatgtggcagctctaccct
gatggacgataccgatcctcagactccagtttctggcgcttagtgtaccacatcaagatt
gacggcgtggaggacatgcttctcgagctgctgccagatgactga

KEGG   Homo sapiens (human): 9623
Entry
9623              CDS       T01001                                 

Gene name
TCL1B, SYN-1, TML1
Definition
(RefSeq) TCL1 family AKT coactivator B
  KO
K16836  T-cell leukemia/lymphoma 1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    9623 (TCL1B)
SSDB
Motif
Pfam: TCL1_MTCP1
Other DBs
NCBI-GeneID: 9623
NCBI-ProteinID: NP_004909
OMIM: 603769
HGNC: 11649
Ensembl: ENSG00000213231
Vega: OTTHUMG00000028912
Pharos: O95988(Tdark)
UniProt: O95988 A0A024R6P4
LinkDB
Position
14q32.13
AA seq 128 aa
MASEASVRLGVPPGRLWIQRPGIYEDEEGRTWVTVVVRFNPSRREWARASQGSRYEPSIT
VHLWQMAVHTRELLSSGQMPFSQLPAVWQLYPGRKYRAADSSFWEIADHGQIDSMEQLVL
TYQPERKD
NT seq 387 nt   +upstreamnt  +downstreamnt
atggcctccgaagcttctgtgcgtctaggggtgccccctggccgtctgtggatccagagg
cctggcatctacgaagatgaggaggggagaacctgggtgactgtggtcgtgcggttcaat
ccctcgcgtagggaatgggccagggcctcccagggcagcagatatgaacccagcatcaca
gtgcacttgtggcagatggcagtgcatacccgggagctactctcctccggccagatgccc
ttctcccagctgcccgccgtgtggcagctctaccccgggaggaagtaccgagcagcggat
tccagtttctgggaaatagcagaccatggccagattgactctatggagcagctggtccta
acatatcagccggagaggaaagactga

DBGET integrated database retrieval system