KEGG   Homo sapiens (human): 4536Help
Entry
4536              CDS       T01001                                 

Gene name
ND2, MTND2, MT-ND2
Definition
(RefSeq) MTND2
  KO
K03879  NADH-ubiquinone oxidoreductase chain 2 [EC:1.6.5.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa05012  Parkinson's disease
Module
hsa_M00142  NADH:ubiquinone oxidoreductase, mitochondria
Disease
H00068  Leber hereditary optic atrophy (LHON)
H00473  Mitochondrial complex I deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    4536 (ND2)
 Organismal Systems
  Nervous system
   04723 Retrograde endocannabinoid signaling
    4536 (ND2)
  Environmental adaptation
   04714 Thermogenesis
    4536 (ND2)
 Human Diseases
  Neurodegenerative diseases
   05012 Parkinson's disease
    4536 (ND2)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.3  NADH:ubiquinone reductase (H+-translocating)
     4536 (ND2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Mitochondrial respiratory chain complex I
    4536 (ND2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proton_antipo_M NADH_dehy_S2_C
Motif
Other DBs
NCBI-GeneID: 4536
NCBI-ProteinID: YP_003024027
OMIM: 516001
HGNC: 7456
Pharos: P03891(Tclin)
UniProt: P03891 Q7GXY9
LinkDB All DBs
Structure
PDB: 

Position
MT
AA seq 347 aa AA seqDB search
MNPLAQPVIYSTIFAGTLITALSSHWFFTWVGLEMNMLAFIPVLTKKMNPRSTEAAIKYF
LTQATASMILLMAILFNNMLSGQWTMTNTTNQYSSLMIMMAMAMKLGMAPFHFWVPEVTQ
GTPLTSGLLLLTWQKLAPISIMYQISPSLNVSLLLTLSILSIMAGSWGGLNQTQLRKILA
YSSITHMGWMMAVLPYNPNMTILNLTIYIILTTTAFLLLNLNSSTTTLLLSRTWNKLTWL
TPLIPSTLLSLGGLPPLTGFLPKWAIIEEFTKNNSLIIPTIMATITLLNLYFYLRLIYST
SITLLPMSNNVKMKWQFEHTKPTPFLPTLIALTTLLLPISPFMLMIL
NT seq 1042 nt NT seq  +upstreamnt  +downstreamnt
attaatcccctggcccaacccgtcatctactctaccatctttgcaggcacactcatcaca
gcgctaagctcgcactgattttttacctgagtaggcctagaaataaacatgctagctttt
attccagttctaaccaaaaaaataaaccctcgttccacagaagctgccatcaagtatttc
ctcacgcaagcaaccgcatccataatccttctaatagctatcctcttcaacaatatactc
tccggacaatgaaccataaccaatactaccaatcaatactcatcattaataatcataata
gctatagcaataaaactaggaatagccccctttcacttctgagtcccagaggttacccaa
ggcacccctctgacatccggcctgcttcttctcacatgacaaaaactagcccccatctca
atcatataccaaatctctccctcactaaacgtaagccttctcctcactctctcaatctta
tccatcatagcaggcagttgaggtggattaaaccaaacccagctacgcaaaatcttagca
tactcctcaattacccacataggatgaataatagcagttctaccgtacaaccctaacata
accattcttaatttaactatttatattatcctaactactaccgcattcctactactcaac
ttaaactccagcaccacgaccctactactatctcgcacctgaaacaagctaacatgacta
acacccttaattccatccaccctcctctccctaggaggcctgcccccgctaaccggcttt
ttgcccaaatgggccattatcgaagaattcacaaaaaacaatagcctcatcatccccacc
atcatagccaccatcaccctccttaacctctacttctacctacgcctaatctactccacc
tcaatcacactactccccatatctaacaacgtaaaaataaaatgacagtttgaacataca
aaacccaccccattcctccccacactcatcgcccttaccacgctactcctacctatctcc
ccttttatactaataatcttat

DBGET integrated database retrieval system