KEGG   Homo sapiens (human): 4583Help
Entry
4583              CDS       T01001                                 

Gene name
MUC2, MLP, MUC-2, SMUC
Definition
(RefSeq) mucin 2, oligomeric mucus/gel-forming
  KO
K10955  mucin-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa05146  Amoebiasis
hsa05226  Gastric cancer
Network
nt06240  Transcription
nt06261  Gastric cancer
  Element
N00250  CDX2-overexpression to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09162 Cancer: specific types
   05226 Gastric cancer
    4583 (MUC2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    4583 (MUC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4583 (MUC2)
Membrane trafficking [BR:hsa04131]
 Others
  Mucins
   Secretory mucins
    4583 (MUC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWD C8 Mucin2_WxxW TIL VWC Pacifastin_I
Motif
Other DBs
NCBI-GeneID: 4583
NCBI-ProteinID: NP_002448
OMIM: 158370
HGNC: 7512
LinkDB All DBs
Position
11p15.5
AA seq 5289 aa AA seqDB search
MGLPLARLAAVCLALSLAGGSELQTEGRTRNHGHNVCSTWGNFHYKTFDGDVFRFPGLCD
YNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTP
HYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSE
FLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
VPLEPYLRACQQDRCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLV
YLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLY
TPGQEITNDCEQCVCNAGRWVCKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKG
DHNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNVVVFKSDGSVLLNELQVNLPHVTA
SFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFK
TASGLVEATGAGFANTWKAQSSCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGR
CHSAVDPAEYYKRCKYDTCNCQNNEDCLCAALSSYARACTAKGVMLWGWREHVCNKDVGS
CPNSQVFLYNLTTCQQTCRSLSEADSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSC
YHRGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPR
ALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCN
TCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSF
SIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVV
ESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNS
WKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSC
SCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNR
SFETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGA
SVPTEETCKSCVCTNSSQVVCRPEEGKILNQTQDGAFCYWEICGPNGTVEKHFNICSITT
RPSTLTTFTTITLPTTPTTFTTTTTTTTPTSSTVLSTTPKLCCLWSDWINEDHPSSGSDD
GDRETFDGVCGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVGFICKNEDQFGNGPFGLCY
DYKIRVNCCWPMDKCITTPSPPTTTPSPPPTSTTTLPPTTTPSPPTTTTTTPPPTTTPSP
PITTTTTPPPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTP
SPPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTT
TPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSP
PTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTT
PSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPP
TTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFH
KPGGDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGV
IPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTPTPITTTTTVTPTPTPTSTQSTTPTP
ITTTNTVTPTPTPTGTQTPTPTPITTTTTMVTPTPTITSTQTPTPTPITTTTVTPTPTPT
STQRTTPTSITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPISTTT
MVTPTPTPTGTQTLTPTPITTTTTVTPTPTPTGTQTPTSTPISTTTTVTPTPTPTGTQTP
TLTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTKSTTPTSITTTTMVTPT
PPPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTPTPITTTTTVTPTPTPTGTQTPTSTPI
TTNTTVTPTPTPTGTPSTTLTPITTTTMVTPTPTPTGTQTPTSTPISTTTTVTPTPTPTG
TQTPTPTPISTTTTVTPTPTPTSTQTPTTTPITTTTTVTPNPTPTGTQTPTTTPITTTTT
VTPTPTPTGTQTPTTTPISTTTTVTPTPTPTGTQTPTTTAITTTTTVTPTPTPTGTQTPT
STPITTTTTVTPTPTPTGTQTPTSTPISNTTTVTPTPTPTGTQTPTVTPITTTTTVTPTR
TPTGTKSTTPTSITTTTMVTPTPTPTGTHTPTTTPITTTTTVTPTPTPTGTQTPTPTPIT
TTTTVTPTPTPTGTQTPTSTPITTTTTVTPTPTPTGTQTPTTTPITTNTTVTPTPTPTGT
QTPTTVLITTTTTMTPTPTPTSTKSTTVTPITTTTTVTPTPTPTGTQSTTLTPITTTTTV
TPTPTPTGTQTPTTTPISTTTTVIPTPTPTGTQTPTSTPITTTTTVTPTPTPTGTQTPTS
TPISTTTTVTPTATPTGTQTPTLTPITTTTTVTSTPTPTGTQTPTPTPITTTTTVTPTPT
PTSTQTPTSTPITTTTTVTPTPTPTGTQTPTTTHITTTTTVTPTPTPTGTQAPTPTAITT
TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQSPTPTAITTTTTVTPTPTPTGTQ
TPTTTPITTTTTVTPTPTPTGTQSTTLTPITTTTTVTPIPTPTGTQTPTSTPITTTITVT
PTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT
PISTTTTVTPTPTPTGTQTPTSTPITTTTTVTPTPTPTGTQTPTPTPITTTTTVTPTPTP
TGTQTPTSTPITTTTTVTPTPTPTGTQTPTPTPITTTTTVTPTPTPTGTQTPTSTPITTT
TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQSTTLTPITTTTTVTPTPTPTGTQT
PTSTPITTTTTVTPTPTGTQTPTPTPISTTTTVTPTPTPTGTQTPTMTPITTTTTVTPTP
TPTGTQTPTTTPISTTTTVTPTPTPTGTQTPTSTPITTTTTVTPTPTPTGTQTPTTTPIT
TTTTVTPTPTPTGTQSTTLTPITTTTTVTPTPTPTGTQTPTPTPISTTTTVTPTPTPTGT
QTPTTTPITTTTTVTPTPTPTGTQTPTTTPISTTTTVTPTPTPTGTQTPTSTPITTTTTV
TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQAPTPTAITTTTTVTPTPTPTGTQTPTT
TPITTTTMVTPTPTPTGTQTPTSTPITTTTTVTPTPTPTGTQTPTPTPISTTTTVTPTPT
PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPISTTTTVTPTPTPTGTQTPTSTPITT
TTTVTPTPTPTGTQTPTPTPITTTTTVTPTPTPTGTQTPTSTPITTTTTVTPTPTPTGTQ
TPTTTPITTTTTVTPTPTPTGTQSTTLTPITTTTTVTPTPTPTGTQTPTSTPITTTTTVT
PTPTPTGTQTPTPTPISTTSTVTPTPTPTGTQTPTMTPITTTTTVTPTPTPTGTQTPTST
PITTTTTVTPTPTPTGTQTPTMTPITTTTTVTPTPTPTGTQAPTPTAITTTTTVTPTPTP
TGTQTPTTTPITTTTTVTPTPTPTGTQSTTLTPITTTTTVTPTPTPTGTQTPTPTPISTT
TTVTPTPTPTGTQTPTMTPITTTTTVTPTPTPTGTQTPTTTPISTTTTVTPTPTPTGTQT
PTTTPITTTTTVTPTPTPTGTQTPTTTPISTTTTVTPTPTPTGTQTPTTTPITTTTTVTP
TPTPTGTQTPTTTPISTTTTVTPTPTPTGTQTPTSTPITTTTTVTPTPTPTGTQTPTTTP
ITTTTTVTPTPTPTGTQAPTPTAITTTSTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT
GTQSPTPTAITTTTTVTPTPTPTGTQTPTLTPITTTTTVTPTPTPTGTQTPTPTPISTTT
TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTVLITTTTTMTPTPTPTSTKST
TVTPITTTTTVTATPTPTGTQTPTMIPISTTTTVTPTPTPTTGSTGPPTHTSTAPIAELT
TSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPTTTSGGHTLSP
PPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTPLSTPSIIRTTGLRPYPS
SVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTPSPTPTPSKST
PTPSKPSSTPSKPTPGTKPPECPDFDPPRQENETWWLCDCFMATCKYNNTVEIVKVECEP
PPMPTCSNGLQPVRVEDPDGCCWHWECDCYCTGWGDPHYVTFDGLYYSYQGNCTYVLVEE
ISPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQVQVQVNRQAVA
LPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRLPYHRFGNNTKGQCGTCTNTTS
DDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGKTTPHKDCTPS
PLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMPGSSLECASLQAYAALCAQQNICLDW
RNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNTVLVEGCFCPEGTMNYAPGFDV
CVKTCGCVGPDNVPREFGEHFEFDCKNCVCLEGGSGIICQPKRCSQKPVTHCVEDGTYLA
TEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKMVPGRCCPFYWCESKGVCVHGN
AEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCNTSCSPGFELMEAPGECCKKC
EQTHCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNITCPNFDASICI
PGSITFMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGCTKTVLMNHCSGSCGTFVMYSA
KAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPTGTSRRAR
RSPRHLGSG
NT seq 15870 nt NT seq  +upstreamnt  +downstreamnt
atggggctgccactagcccgcctggcggctgtgtgcctggccctgtctttggcagggggc
tcggagctccagacagagggcagaacccgaaaccacggccacaacgtctgcagcacctgg
ggcaacttccactacaagaccttcgacggggacgtcttccgcttccccggcctctgcgac
tacaacttcgcctccgactgccgaggctcctacaaggaatttgctgtgcacctgaagcgg
ggtccgggccaggctgaggcccccgccggggtggagtccatcctgctgaccatcaaggat
gacaccatctacctcacccgccacctggctgtgcttaacggggccgtggtcagcaccccg
cactacagccccgggctgctcattgagaagagcgatgcctacaccaaagtctactcccgc
gccggcctcaccctcatgtggaaccgggaggatgcactcatgctggagctggacactaag
ttccggaaccacacctgtggcctctgcggggactacaacggcctgcagagctattcagaa
ttcctctctgacggcgtgctcttcagtcccctggagtttgggaacatgcagaagatcaac
cagcccgatgtggtgtgtgaggatcccgaggaggaggtggcccccgcatcctgctccgag
caccgcgccgagtgtgagaggctgctgaccgccgaggccttcgcggactgtcaggacctg
gtgccgctggagccgtatctgcgcgcctgccagcaggaccgctgccggtgcccgggcggt
gacacctgcgtctgcagcaccgtggccgagttctcccgccagtgctcccacgccggcggc
cggcccgggaactggaggaccgccacgctctgccccaagacctgccccgggaacctggtg
tacctggagagcggctcgccctgcatggacacctgctcacacctggaggtgagcagcctg
tgcgaggagcaccgcatggacggctgtttctgcccagaaggcaccgtatatgacgacatc
ggggacagtggctgcgttcctgtgagccagtgccactgcaggctgcacggacacctgtac
acaccgggccaggagatcaccaatgactgcgagcagtgtgtctgtaacgctggccgctgg
gtgtgcaaagacctgccctgccccggcacctgtgccctggaaggcggctcccacatcacc
accttcgatgggaagacgtacaccttccacggggactgctactatgtcctggccaagggt
gaccacaacgattcctacgctctcctgggcgagctggccccctgtggctccacagacaag
cagacctgcctgaagacggtggtgctgctggctgacaagaagaagaatgtggtggtcttc
aagtccgatggcagtgtactgctcaacgagctgcaggtgaacctgccccacgtgaccgcg
agcttctctgtcttccgcccgtcttcctaccacatcatggtgagcatggccattggcgtc
cggctgcaggtgcagctggccccagtcatgcaactctttgtgacactggaccaggcctcc
caggggcaggtgcagggcctctgcgggaacttcaacggcctggaaggtgacgacttcaag
acggccagcgggctggtggaggccacgggggccggctttgccaacacctggaaggcacag
tcaagctgccatgacaagctggactggttggacgatccctgctccctgaacatcgagagc
gccaactacgccgagcactggtgctccctcctgaagaagacagagaccccctttggcagg
tgccactcggctgtggaccctgctgagtattacaagaggtgcaaatatgacacgtgtaac
tgtcagaacaatgaggactgcctgtgcgccgccctgtcctcctacgcgcgcgcctgcacc
gccaagggcgtcatgctgtggggctggcgggagcatgtctgcaacaaggatgtgggctcc
tgccccaactcgcaggtcttcctgtacaacctgaccacctgccagcagacctgccgctcc
ctctccgaggccgacagccactgtctcgagggctttgcgcctgtggacggctgcggctgc
cctgaccacaccttcctggacgagaagggccgctgcgtacccctggccaagtgctcctgt
taccaccgcggtctctacctggaggcgggggatgtggtcgtcaggcaggaagaacgatgt
gtgtgccgggatgggcggctgcactgtaggcagatccggctgatcggccagagctgcacg
gccccaaagatccacatggactgcagcaacctgactgcactggccacctcgaagccccga
gccctcagctgccagacgctggccgccggctattaccacacagagtgtgtcagtggctgt
gtgtgccccgacgggctgatggatgacggccggggtggctgcgtggtggagaaggaatgc
ccttgcgtccataacaacgacctgtattcttccggcgccaagatcaaggtggactgcaat
acctgcacctgcaagagaggacgctgggtgtgcacccaggctgtgtgccatggcacctgc
tccatttacgggagtggccactacatcacctttgatgggaagtactacgactttgacgga
cactgctcctacgtggctgttcaggactactgcggccagaactcctcactgggctcattc
agcatcatcaccgagaacgtcccctgtggcactacgggcgtcacctgctccaaggccatc
aagatcttcatggggaggacggagctgaagttggaagacaagcaccgtgtggtgatccag
cgtgatgagggtcaccacgtggcctacaccacgcgggaggtgggccagtacctggtggtg
gagtccagcacgggcatcatcgtcatctgggacaagaggaccaccgtgttcatcaagctg
gctccctcctacaagggcaccgtgtgtggcctgtgtgggaactttgaccaccgctccaac
aacgacttcaccacgcgggaccacatggtggtgagcagcgagctggacttcgggaacagc
tggaaggaggcccccacctgcccagatgtgagcaccaaccccgagccctgcagcctgaac
ccgcaccgccgctcctgggccgagaagcagtgcagcatcctcaaaagcagcgtgttcagc
atctgccacagcaaggtggaccccaagcccttctacgaggcctgtgtgcacgactcgtgc
tcctgtgacacgggtggggactgtgagtgcttctgctctgccgtggcctcctacgcccag
gagtgtaccaaagagggggcctgcgtgttctggaggacgccggacctgtgccccatattc
tgcgactactacaaccctccgcatgagtgtgagtggcactatgagccatgtgggaaccgg
agcttcgagacctgcaggaccatcaacggcatccactccaacatctccgtgtcctacctg
gagggctgctacccccggtgccccaaggacaggcccatctatgaggaggatctgaagaag
tgtgtcactgcagacaagtgtggctgctatgtcgaggacacccactacccacctggagca
tcggttcccaccgaggagacctgcaagtcctgcgtgtgtaccaactcctcccaagtcgtc
tgcaggccggaggaaggaaagattcttaaccagacccaggatggcgccttctgctactgg
gagatctgtggccccaacgggacggtggagaagcacttcaacatctgttccattacgaca
cgcccgtccaccctgaccaccttcaccaccatcaccctccccaccacccccaccaccttc
accactaccaccaccaccaccaccccgacctccagcacagttttatcaacaactccgaag
ctgtgctgcctctggtctgactggatcaatgaggaccaccccagcagtggcagcgacgac
ggtgaccgagaaacatttgatggggtctgcggggcccctgaggacatcgagtgcaggtcg
gtcaaggatccccacctcagcttggagcagctaggccagaaggtgcagtgtgatgtctct
gttgggttcatttgcaagaatgaagaccagtttggaaatggaccatttggactgtgttac
gactacaagatacgtgtcaattgttgctggcccatggataagtgtatcaccactcccagc
cctccaactaccactcccagccctccaccaaccagcacgaccacccttccaccaaccacc
acccccagccctccaaccaccaccacaaccacccctccaccaaccaccacccccagccct
ccaataaccaccacgaccacccctccaccaaccaccactcccagccctccaataagcacc
acaaccacccctccaccaaccaccactcccagccctccaaccaccactcccagccctcca
accaccactcccagccctccaacaaccaccacaaccacccctccaccaaccaccactccc
agccctccaacgactacgcccatcactccaccagccagcactaccacccttccaccaacc
accactcccagccctccaacaaccaccacaaccacccctccaccaaccaccactcccagt
cctccaacgactacgcccatcactccaccaaccagcactactacccttccaccaaccacc
actcccagccctccaccaaccaccacaaccacccctccaccaaccaccactcccagccct
ccaacaaccaccactcccagtcctccaacaatcaccacaaccacccctccaccaaccacc
actcccagccctccaacaacgaccacaaccacccctccaccaaccaccactcccagccct
ccaacgactacacccatcactccaccaaccagcactaccacccttccaccaaccaccact
cccagccctccaccaaccaccacaaccacccctccaccaaccaccactcccagccctcca
acaaccaccactcccagccctccaataaccaccacaaccacccctccaccaaccaccact
cccagctctccaataaccaccactcccagccctccaacaaccaccatgaccaccccttca
ccaaccaccacccccagctctccaataaccaccacaaccaccccttcctcaactaccact
cccagccctccaccaaccaccatgaccaccccttcaccaaccaccactcccagccctcca
acaaccaccatgaccacccttccaccaaccaccacttccagccctctaacaactactcct
ctacctccatcaataactcctcctacattttcaccattctcaacgacaacccctactacc
ccatgcgtgcctctctgcaattggactggctggctggattctggaaaacccaactttcac
aaaccaggtggagacacagaattgattggagacgtctgtggaccaggctgggcagctaac
atctcttgcagagccaccatgtatcctgatgttcccattggacagcttggacaaacagtg
gtgtgtgatgtctctgtggggctgatatgcaaaaatgaagaccaaaagccaggtggggtc
atccctatggccttctgcctcaactacgagatcaacgttcagtgctgtgagtgtgtcacc
caacccaccaccatgacaaccaccaccacagagaacccaactccgacaccaatcaccacc
accactacggtgaccccaaccccaacacccaccagcacacagagtacaacaccaacaccc
atcaccaccaccaatacggtaaccccaaccccaacccccactggcacacagaccccaacc
ccgacacccatcaccaccaccaccactatggtgaccccaacaccaacaatcaccagcaca
cagaccccaaccccgacacccatcaccaccactacggtgaccccaaccccaacacccacc
agcacacagagaacaacaccgacatccatcaccaccaccaccacggtgaccccaacccca
acacccaccggcacacagaccccaaccacgacacccatcaccaccaccaccacggtgacc
ccaaccccaacacccaccggcacacagaccccaacaacgacacccatcagcaccaccacc
atggtgaccccaaccccaacacccactggaacacagaccctaaccccaacacccatcacc
accaccactacggtgaccccaacccctacacccaccggcacacagaccccaacatcgaca
cccatcagcaccaccactacggtgaccccaacaccaacacccaccggcacacagacccca
accctgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcaca
cagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacaccc
accggcacaaagagtacaaccccgacatccatcaccaccaccactatggtgaccccaacc
ccaccacccactggcacacagaccccaaccacgacacccatcaccaccaccactacggtg
accccaaccccaacacccaccggcacacagaccccaaccccgacacccatcaccaccacc
accacggtgaccccaaccccaacacccaccggcacacagaccccaacatcgacacccatc
accaccaacactacggtgaccccaaccccaacaccaaccggcacaccgagtacaaccctg
acacccatcaccaccaccactatggtgaccccaaccccaacacccactggcacacagacc
ccaacatcgacacccatcagcaccaccactacggtgaccccaaccccaacacccaccggc
acacagaccccaaccccgacacccatctccaccaccactacggtgaccccaaccccaaca
cccaccagcacacagaccccaaccacgacacccatcaccaccaccaccacggtgacccca
aacccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccaccacg
gtgaccccaaccccaacacccaccggcacacagaccccaacaacgacacccatcagcacc
accaccacggtgaccccaaccccaacacccactggcacacagaccccaaccacaacagcc
atcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaca
tcgacacccatcaccaccaccactacggtgaccccaacccctacacccaccggcacacag
accccaacatcgacacccatcagcaacaccactacggtgacgccaacaccaacacccacc
ggcacacagaccccaaccgtgacacccatcaccaccaccactacggtgaccccaacccga
acacccaccggcacaaagagtacaaccccgacatccatcaccaccaccactatggtgacc
ccaaccccaacacccactggcacacataccccaaccacgacacccatcaccaccaccact
acggtgaccccaaccccaacacccaccggcacacagaccccaaccccgacacccatcacc
accaccaccacggtgaccccaaccccaacacccaccggcacacagaccccaacatcgaca
cccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacccca
accacgacacccatcaccaccaacaccacggtgaccccaaccccgacacccaccggcaca
cagaccccaaccacggtactcatcaccaccaccactacgatgacaccaaccccaacaccc
accagcacaaagagtacaaccgtgacacccatcaccaccaccactaccgtgaccccaacc
ccaacacccaccggcacacagagtacaaccctgacacccatcaccaccaccactacggtg
accccaaccccaacacccaccggcacacagaccccaacaacgacacccatcagcaccacc
accaccgtgatcccaaccccaacacccaccggcacacagaccccaacatcgacacccatc
accaccaccactacggtgaccccaacccctacacccactggcacacagaccccaacatcg
acacccatcagcaccaccactacggtgaccccaacagcaacacccaccggcacacagacc
ccaaccctgacacccatcaccaccaccactacggtgacctcaaccccaacacccaccggc
acacagaccccaaccccgacacccatcaccaccaccaccacggtgaccccaaccccaaca
cccaccagcacacagaccccaacatcgacacccatcaccaccaccactacggtgacccca
accccaacacccactggcacacagaccccaaccacgacacacattaccaccaccaccacg
gtgaccccaaccccaacacccactggcacacaggccccaaccccaacagccatcaccacc
accactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacaccc
atcaccaccaccactacggtgacaccaaccccaacacccaccggcacacagtccccaacc
ccaacagccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacag
accccaaccacgacacccatcaccaccaccaccacggtgaccccaaccccgacacccacc
ggcacacagagtacaaccctgacacccatcaccaccaccaccacggtgacaccaatccca
acacccactggcacacagaccccaacatcgacacccatcaccaccaccattacggtgacc
ccaaccccaacacccaccggcacacagaccccaaccccgacacccatctccaccaccact
acggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcacc
accaccaccacggtgaccccaaccccaacacccaccggcacacagaccccaacaacgaca
cccatcagcaccaccaccacggtgaccccaaccccaacacccaccggcacacagacccca
acatcgacacccatcaccaccaccaccacggtgaccccaaccccaacacccaccggcaca
cagaccccaaccccgacacccatcaccaccaccaccacggtgaccccaaccccaacaccc
accggcacacagaccccaacatcgacacccatcaccaccacgactacggtgaccccaacc
ccaacacccaccggcacacagaccccaaccccgacacccatcaccaccaccaccacggtg
accccaaccccaacacccaccggcacacagaccccaacatcgacacccatcaccaccacc
actacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatc
accaccaccaccacggtgaccccaaccccaacacccactggcacacagagtacaaccctg
acacccatcaccaccaccaccacggtgacaccaaccccaacacccaccggcacacagacc
ccaacatcgacacccatcaccaccaccactacggtgaccccaacacccaccggcacacag
accccaaccccgacacccatctccaccaccactacagtgaccccaaccccaacacccacc
ggcacacagaccccaaccatgacacccatcaccaccaccaccacggtgaccccaacccca
acacccaccggcacacagaccccaacaacgacacccatcagcaccaccaccacagtgacc
ccaaccccaacacccaccggcacacagaccccaacatcgacacccatcaccaccaccact
acggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcacc
accaccaccacggtgaccccaaccccaacacccaccggcacacagagtacaaccctgaca
cccatcaccaccaccaccacggtgacaccaaccccaacacccaccggcacacagacccca
accccgacacccatctccaccaccactacggtgaccccaaccccaacacccaccggcaca
cagaccccaaccacgacacccatcaccaccaccaccacggtgaccccaaccccaacaccc
accggcacacagaccccaacaacgacacccatcagcaccaccaccacggtgaccccaacc
ccaacacccaccggcacacagaccccaacatcgacacccatcaccaccaccactacggtg
accccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccacc
accacggtgaccccaaccccaacacccactggcacacaggccccaaccccaacagccatc
accaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaacaaca
acacccatcaccaccaccaccatggtgaccccaaccccaacacccaccggcacacagacc
ccaacatcgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggc
acacagaccccaaccccgacacccatctccaccaccactacggtgaccccaaccccaaca
cccaccggcacacagaccccaaccacgacacccatcaccaccaccaccacggtgacccca
accccaacacccaccggcacacagaccccaacaacgacacccatcagcaccaccaccacg
gtgaccccaaccccaacacccaccggcacacagaccccaacatcgacacccatcaccacc
accactacggtgaccccaaccccaacacccaccggcacacagaccccaaccccgacaccc
atcaccaccaccaccacggtgaccccaaccccaacacccaccggcacacagaccccaaca
tcgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacag
accccaaccacgacacccatcaccaccaccaccacggtgaccccaaccccaacacccacc
ggcacacagagtacaaccctgacacccatcaccaccaccaccacggtgacaccaacccca
acacccaccggcacacagaccccaacatcgacacccatcaccaccaccactacggtgacc
ccaaccccaacacccaccggcacacagaccccaaccccgacacccatctccaccaccagt
acggtgaccccaaccccaacacccaccggcacacagaccccaaccatgacacccatcacc
accaccaccacggtgaccccaaccccaacacccaccggcacacagaccccaacatcgaca
cccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacccca
accatgacacccatcaccaccaccaccacggtgaccccaaccccaacacccactggcaca
caggccccaaccccaacagccatcaccaccaccactacggtgaccccaaccccaacaccc
accggcacacagaccccaaccacgacacccatcaccaccaccaccacggtgaccccaacc
ccaacacccaccggcacacagagtacaaccctgacacccatcaccaccaccaccacggtg
acaccaaccccaacacccaccggcacacagaccccaaccccgacacccatctccaccacc
actacggtgaccccaaccccaacacccaccggcacacagaccccaaccatgacacccatc
accaccaccaccacggtgaccccaaccccaacacccaccggcacacagaccccaacaacg
acacccatcagcaccaccaccacggtgaccccaaccccaacacccaccggcacacagacc
ccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggc
acacagaccccaacaacgacacccatcagcaccaccaccacggtgaccccaaccccaaca
cccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacccca
accccaacacccaccggcacacagaccccaacaacgacacccatcagcaccaccaccacg
gtgaccccaaccccaacacccaccggcacacagaccccaacatcgacacccatcaccacc
accactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacaccc
atcaccaccaccaccacggtgaccccaaccccaacacccactggcacacaggccccaacc
ccaacagccatcaccaccaccagtacggtgaccccaaccccaacacccaccggcacacag
accccaaccacgacacccatcaccaccaccactacggtgacaccaaccccaacacccacc
ggcacacagtccccaaccccaacagccatcaccaccaccactacggtgaccccaacccca
acacccaccggcacacagaccccaacattgacacccatcaccaccaccactacggtgacc
ccaaccccaacacccaccggcacacagaccccaaccccgacacccatctccaccaccact
acggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcacc
accaccaccacggtgaccccaaccccgacacccaccggcacacagaccccaaccacggta
ctcatcaccaccaccactacgatgaccccaaccccaacacccaccagcacaaagagtaca
accgtgacacccatcaccaccacaactacggtgaccgcaaccccaacacccaccggcaca
cagaccccaaccatgatacccatcagcaccaccactacggtgaccccaaccccaacaccc
accactggaagcacggggccccccacccacacaagcacagcaccgattgctgagttgacc
acatccaatcctccgcctgagtcctcaacccctcagacctctcggtccacctcttcccct
ctcacggagtcaaccacccttctgagtaccctaccacctgccattgagatgaccagcacg
gccccaccctccacacccacggcacccacgaccacgagcggaggccacacactgtctcca
ccgcccagcaccaccacgtcccctccaggcacccccactcgcggtaccacgactgggtca
tcttcagcccccacccccagcactgtgcagacgaccaccaccagtgcctggacccccacg
ccgaccccactctccacacccagcatcatcaggaccacaggcctgaggccctacccttcc
tctgtgcttatctgctgtgtcctgaacgacacctactacgcaccaggtgaggaggtgtac
aacggcacatacggagacacctgttatttcgtcaactgctcactgagctgtacgttggag
ttctataactggtcctgcccatccacgccctccccaacacccacgccctccaagtcgacg
cccacgccttccaagccatcgtccacgccctccaagccgacgcccggcaccaagcccccc
gagtgcccagactttgatcctcccagacaggagaacgagacttggtggctgtgcgactgc
ttcatggccacgtgcaagtacaacaacacggtggagatcgtgaaggtggagtgtgagccg
ccgcccatgcccacctgctccaacggcctccaacccgtgcgcgtcgaggaccccgacggc
tgctgctggcactgggagtgcgactgctactgcacgggctggggcgacccgcactatgtc
accttcgacggactctactacagctaccagggcaactgcacctacgtgctggtggaggag
atcagcccctccgtggacaacttcggagtttacatcgacaactaccactgcgatcccaac
gacaaggtgtcctgcccccgcaccctcatcgtgcgccacgagacccaggaggtgctgatc
aagaccgtgcatatgatgcccatgcaggtgcaggtgcaggtgaacaggcaggcggtggca
ctgccctacaagaagtacgggctggaggtgtaccagtctggcatcaactacgtggtggac
atccccgagctgggtgtcctcgtctcctacaatggcctgtccttctccgtcaggctgccc
taccaccggtttggcaacaacaccaagggccagtgtggcacctgcaccaacaccacctcc
gacgactgcattctgcccagcggggagatcgtctccaactgtgaggctgcggctgaccag
tggctggtgaacgacccctccaagccacactgcccccacagcagctccacgaccaagcgc
ccggccgtcactgtgcccgggggcggtaaaacgaccccacacaaggactgcaccccatct
cccctctgccagctcatcaaggacagcctgtttgcccagtgccacgcactggtgcccccg
cagcactactacgatgcctgcgtgttcgacagctgcttcatgccgggctcgagcctggag
tgcgccagtctgcaggcctacgcagccctctgtgcccagcagaacatctgcctcgactgg
cggaaccacacgcatggggcctgcttggtggagtgcccatctcacagggagtaccaggcc
tgtggccctgcagaagagcccacgtgcaaatccagctcctcccagcagaacaacacagtc
ctggtggaaggctgcttctgtcctgagggcaccatgaactacgctcctggctttgatgtc
tgcgtgaagacctgcggctgtgtgggacctgacaatgtgcccagagagtttggggagcac
ttcgagttcgactgcaagaactgtgtctgcctggagggtggaagtggcatcatctgccaa
cccaagaggtgcagccagaagcccgttacccactgcgtggaagacggcacctacctcgcc
acggaggtcaaccctgccgacacctgctgcaacattaccgtctgcaagtgcaacaccagc
ctgtgcaaagagaagccctccgtgtgcccgctgggattcgaagtgaagagcaagatggtg
cctggaaggtgctgtcccttctactggtgtgagtccaagggggtgtgtgttcacgggaat
gctgagtaccagcccggttctccagtttattcctccaagtgccaggactgcgtgtgcacg
gacaaggtggacaacaacaccctgctcaacgtcatcgcctgcacccacgtgccctgcaac
acctcctgcagccctggcttcgaactcatggaggcccccggggagtgctgtaagaagtgt
gaacagacgcactgtatcatcaaacggcccgacaaccagcacgtcatcctgaagcccggg
gacttcaagagcgacccgaagaacaactgcacattcttcagctgcgtgaagatccacaac
cagctcatctcgtccgtctccaacatcacctgccccaactttgatgccagcatttgcatc
ccgggctccatcacattcatgcccaatggatgctgcaagacctgcacccctcgcaatgag
accagggtgccctgctccaccgtccccgtcaccacggaggtttcgtacgccggctgcacc
aagaccgtcctcatgaatcattgctccgggtcctgcgggacatttgtcatgtactcggcc
aaggcccaggccctggaccacagctgctcctgctgcaaagaggagaaaaccagccagcgt
gaggtggtcctgagctgccccaatggcggctcgctgacacacacctacacccacatcgag
agctgccagtgccaggacaccgtctgcgggctccccaccggcacctcccgccgggcccgg
cgctcccctaggcatctggggagcgggtga

KEGG   Homo sapiens (human): 1015Help
Entry
1015              CDS       T01001                                 

Gene name
CDH17, CDH16, HPT-1, HPT1
Definition
(RefSeq) cadherin 17
  KO
K06811  cadherin 17, LI cadherin
Organism
hsa  Homo sapiens (human)
Pathway
hsa05226  Gastric cancer
Network
nt06240  Transcription
nt06261  Gastric cancer
  Element
N00250  CDX2-overexpression to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09162 Cancer: specific types
   05226 Gastric cancer
    1015 (CDH17)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    1015 (CDH17)
Cell adhesion molecules [BR:hsa04515]
 Cadherins
  Major cadherins
   1015 (CDH17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cadherin Cadherin_3 Cadherin_4 RET_CLD1
Motif
Other DBs
NCBI-GeneID: 1015
NCBI-ProteinID: NP_001138135
OMIM: 603017
HGNC: 1756
Ensembl: ENSG00000079112
Vega: OTTHUMG00000164391
Pharos: Q12864(Tbio)
UniProt: Q12864
LinkDB All DBs
Position
8q22.1
AA seq 832 aa AA seqDB search
MILQAHLHSLCLLMLYLATGYGQEGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTF
ELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIKVKDIN
DNRPTFLQSKYEGSVRQNSRPGKPFLYVNATDLDDPATPNGQLYYQIVIQLPMINNVMYF
QINNKTGAISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWK
APKPVEMVENSTDPHPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDR
EEKDAYVFYAVAKDEYGKPLSYPLEIHVKVKDINDNPPTCPSPVTVFEVQENERLGNSIG
TLTAHDRDEENTANSFLNYRIVEQTPKLPMDGLFLIQTYAGMLQLAKQSLKKQDTPQYNL
TIEVSDKDFKTLCFVQINVIDINDQIPIFEKSDYGNLTLAEDTNIGSTILTIQATDADEP
FTGSSKILYHIIKGDSEGRLGVDTDPHTNTGYVIIKKPLDFETAAVSNIVFKAENPEPLV
FGVKYNASSFAKFTLIVTDVNEAPQFSQHVFQAKVSEDVAIGTKVGNVTAKDPEGLDISY
SLRGDTRGWLKIDHVTGEIFSVAPLDREAGSPYRVQVVATEVGGSSLSSVSEFHLILMDV
NDNPPRLAKDYTGLFFCHPLSAPGSLIFEATDDDQHLFRGPHFTFSLGSGSLQNDWEVSK
INGTHARLSTRHTEFEEREYVVLIRINDGGRPPLEGIVSLPVTFCSCVEGSCFRPAGHQT
GIPTVGMAVGILLTTLLVIGIILAVVFIRIKKDKGKDNVESAQASEVKPLRS
NT seq 2499 nt NT seq  +upstreamnt  +downstreamnt
atgatacttcaggcccatcttcactccctgtgtcttcttatgctttatttggcaactgga
tatggccaagaggggaagtttagtggacccctgaaacccatgacattttctatttatgaa
ggccaagaaccgagtcaaattatattccagtttaaggccaatcctcctgctgtgactttt
gaactaactggggagacagacaacatatttgtgatagaacgggagggacttctgtattac
aacagagccttggacagggaaacaagatctactcacaatctccaggttgcagccctggac
gctaatggaattatagtggagggtccagtccctatcaccataaaagtgaaggacatcaac
gacaatcgacccacgtttctccagtcaaagtacgaaggctcagtaaggcagaactctcgc
ccaggaaagcccttcttgtatgtcaatgccacagacctggatgatccggccactcccaat
ggccagctttattaccagattgtcatccagcttcccatgatcaacaatgtcatgtacttt
cagatcaacaacaaaacgggagccatctctcttacccgagagggatctcaggaattgaat
cctgctaagaatccttcctataatctggtgatctcagtgaaggacatgggaggccagagt
gagaattccttcagtgataccacatctgtggatatcatagtgacagagaatatttggaaa
gcaccaaaacctgtggagatggtggaaaactcaactgatcctcaccccatcaaaatcact
caggtgcggtggaatgatcccggtgcacaatattccttagttgacaaagagaagctgcca
agattcccattttcaattgaccaggaaggagatatttacgtgactcagcccttggaccga
gaagaaaaggatgcatatgttttttatgcagttgcaaaggatgagtacggaaaaccactt
tcatatccgctggaaattcatgtaaaagttaaagatattaatgataatccacctacatgt
ccgtcaccagtaaccgtatttgaggtccaggagaatgaacgactgggtaacagtatcggg
acccttactgcacatgacagggatgaagaaaatactgccaacagttttctaaactacagg
attgtggagcaaactcccaaacttcccatggatggactcttcctaatccaaacctatgct
ggaatgttacagttagctaaacagtccttgaagaagcaagatactcctcagtacaactta
acgatagaggtgtctgacaaagatttcaagaccctttgttttgtgcaaatcaacgttatt
gatatcaatgatcagatccccatctttgaaaaatcagattatggaaacctgactcttgct
gaagacacaaacattgggtccaccatcttaaccatccaggccactgatgctgatgagcca
tttactgggagttctaaaattctgtatcatatcataaagggagacagtgagggacgcctg
ggggttgacacagatccccataccaacaccggatatgtcataattaaaaagcctcttgat
tttgaaacagcagctgtttccaacattgtgttcaaagcagaaaatcctgagcctctagtg
tttggtgtgaagtacaatgcaagttcttttgccaagttcacgcttattgtgacagatgtg
aatgaagcacctcaattttcccaacacgtattccaagcgaaagtcagtgaggatgtagct
ataggcactaaagtgggcaatgtgactgccaaggatccagaaggtctggacataagctat
tcactgaggggagacacaagaggttggcttaaaattgaccacgtgactggtgagatcttt
agtgtggctccattggacagagaagccggaagtccatatcgggtacaagtggtggccaca
gaagtaggggggtcttccttgagctctgtgtcagagttccacctgatccttatggatgtg
aatgacaaccctcccaggctagccaaggactacacgggcttgttcttctgccatcccctc
agtgcacctggaagtctcattttcgaggctactgatgatgatcagcacttatttcggggt
ccccattttacattttccctcggcagtggaagcttacaaaacgactgggaagtttccaaa
atcaatggtactcatgcccgactgtctaccaggcacacagagtttgaggagagggagtat
gtcgtcttgatccgcatcaatgatgggggtcggccacccttggaaggcattgtttcttta
ccagttacattctgcagttgtgtggaaggaagttgtttccggccagcaggtcaccagact
gggatacccactgtgggcatggcagttggtatactgctgaccacccttctggtgattggt
ataattttagcagttgtgtttatccgcataaagaaggataaaggcaaagataatgttgaa
agtgctcaagcatctgaagtcaaacctctgagaagctga

KEGG   Homo sapiens (human): 83998Help
Entry
83998             CDS       T01001                                 

Gene name
REG4, GISP, REG-IV, RELP
Definition
(RefSeq) regenerating family member 4
  KO
K22244  regenerating islet-derived protein 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05226  Gastric cancer
Network
nt06240  Transcription
nt06261  Gastric cancer
  Element
N00250  CDX2-overexpression to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09162 Cancer: specific types
   05226 Gastric cancer
    83998 (REG4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C
Motif
Other DBs
NCBI-GeneID: 83998
NCBI-ProteinID: NP_001152824
OMIM: 609846
HGNC: 22977
Ensembl: ENSG00000134193
Vega: OTTHUMG00000012175
Pharos: Q9BYZ8(Tbio)
UniProt: Q9BYZ8 A0A024R0M1
LinkDB All DBs
Structure
PDB: 

Position
1p12
AA seq 158 aa AA seqDB search
MASRSMRLLLLLSCLAKTGVLGDIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELECQS
YGNGAHLASILSLKEASTIAEYISGYQRSQPIWIGLHDPQKRQQWQWIDGAMYLYRSWSG
KSMGGNKHCAEMSSNNNFLTWSSNECNKRQHFLCKYRP
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atggcttccagaagcatgcggctgctcctattgctgagctgcctggccaaaacaggagtc
ctgggtgatatcatcatgagacccagctgtgctcctggatggttttaccacaagtccaat
tgctatggttacttcaggaagctgaggaactggtctgatgccgagctcgagtgtcagtct
tacggaaacggagcccacctggcatctatcctgagtttaaaggaagccagcaccatagca
gagtacataagtggctatcagagaagccagccgatatggattggcctgcacgacccacag
aagaggcagcagtggcagtggattgatggggccatgtatctgtacagatcctggtctggc
aagtccatgggtgggaacaagcactgtgctgagatgagctccaataacaactttttaact
tggagcagcaacgaatgcaacaagcgccaacacttcctgtgcaagtaccgaccatag

KEGG   Homo sapiens (human): 5243Help
Entry
5243              CDS       T01001                                 

Gene name
ABCB1, ABC20, CD243, CLCS, GP170, MDR1, P-GP, PGY1
Definition
(RefSeq) ATP binding cassette subfamily B member 1
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:7.6.2.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa02010  ABC transporters
hsa04976  Bile secretion
hsa05206  MicroRNAs in cancer
hsa05226  Gastric cancer
Network
nt06240  Transcription
nt06261  Gastric cancer
  Element
N00250  CDX2-overexpression to transcriptional activation
Disease
H01227  Inflammatory bowel disease (IBD)
H01529  Avascular necrosis of femoral head
H01709  Glucocorticoid-induced osteonecrosis
Drug target
Biricodar dicitrate: D03128
Elacridar hydrochloride: D03968
Tariquidar: D06008
Tesmilifene hydrochloride: D06084
Valspodar: D06277
Zosuquidar trihydrochloride: D06387
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    5243 (ABCB1)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    5243 (ABCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    5243 (ABCB1)
  09162 Cancer: specific types
   05226 Gastric cancer
    5243 (ABCB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    5243 (ABCB1)
   04147 Exosome [BR:hsa04147]
    5243 (ABCB1)
   04090 CD molecules [BR:hsa04090]
    5243 (ABCB1)
Enzymes [BR:hsa01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     5243 (ABCB1)
Transporters [BR:hsa02000]
 ABC Transporters, Eukaryotic Type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    5243 (ABCB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   5243 (ABCB1)
CD molecules [BR:hsa04090]
 Proteins
  5243 (ABCB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N ABC_ATPase AAA_16 AAA_22 RsgA_GTPase Rad17 Zeta_toxin G-alpha AAA AAA_29 AAA_5 AAA_7 AAA_15 AAA_14 APS_kinase SbcCD_C AAA_30 PRK DUF815 AAA_24 DUF2207
Motif
Other DBs
NCBI-GeneID: 5243
NCBI-ProteinID: NP_000918
OMIM: 171050
HGNC: 40
Ensembl: ENSG00000085563
Vega: OTTHUMG00000023393
Pharos: P08183(Tchem)
UniProt: P08183 A4D1D2
LinkDB All DBs
Structure
PDB: 

Position
7q21.12
AA seq 1280 aa AA seqDB search
MDLEGDRNGGAKKKNFFKLNNKSEKDKKEKKPTVSVFSMFRYSNWLDKLYMVVGTLAAII
HGAGLPLMMLVFGEMTDIFANAGNLEDLMSNITNRSDINDTGFFMNLEEDMTRYAYYYSG
IGAGVLVAAYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVS
KINEGIGDKIGMFFQSMATFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFT
DKELLAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNKNLEEAKRIGIKKAITANISIG
AAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSVLIGAFSVGQASPSIEAFANARG
AAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVKILKGLNLKVQSG
QTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPVLF
ATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIA
IARALVRNPKILLLDEATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAG
FDDGVIVEKGNHDELMKEKGIYFKLVTMQTAGNEVELENAADESKSEIDALEMSSNDSRS
SLIRKRSTRRSVRGSQAQDRKLSTKEALDESIPPVSFWRIMKLNLTEWPYFVVGVFCAII
NGGLQPAFAIIFSKIIGVFTRIDDPETKRQNSNLFSLLFLALGIISFITFFLQGFTFGKA
GEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGAIGSRLAVITQNI
ANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEA
IENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFG
AYLVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDS
YSTEGLMPNTLEGNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVV
QLLERFYDPLAGKVLLDGKEIKRLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVV
SQEEIVRAAKEANIHAFIESLPNKYSTKVGDKGTQLSGGQKQRIAIARALVRQPHILLLD
EATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVFQNGRVKEHGTHQQL
LAQKGIYFSMVSVQAGTKRQ
NT seq 3843 nt NT seq  +upstreamnt  +downstreamnt
atggatcttgaaggggaccgcaatggaggagcaaagaagaagaacttttttaaactgaac
aataaaagtgaaaaagataagaaggaaaagaaaccaactgtcagtgtattttcaatgttt
cgctattcaaattggcttgacaagttgtatatggtggtgggaactttggctgccatcatc
catggggctggacttcctctcatgatgctggtgtttggagaaatgacagatatctttgca
aatgcaggaaatttagaagatctgatgtcaaacatcactaatagaagtgatatcaatgat
acagggttcttcatgaatctggaggaagacatgaccaggtatgcctattattacagtgga
attggtgctggggtgctggttgctgcttacattcaggtttcattttggtgcctggcagct
ggaagacaaatacacaaaattagaaaacagttttttcatgctataatgcgacaggagata
ggctggtttgatgtgcacgatgttggggagcttaacacccgacttacagatgatgtctcc
aagattaatgaaggaattggtgacaaaattggaatgttctttcagtcaatggcaacattt
ttcactgggtttatagtaggatttacacgtggttggaagctaacccttgtgattttggcc
atcagtcctgttcttggactgtcagctgctgtctgggcaaagatactatcttcatttact
gataaagaactcttagcgtatgcaaaagctggagcagtagctgaagaggtcttggcagca
attagaactgtgattgcatttggaggacaaaagaaagaacttgaaaggtacaacaaaaat
ttagaagaagctaaaagaattgggataaagaaagctattacagccaatatttctataggt
gctgctttcctgctgatctatgcatcttatgctctggccttctggtatgggaccaccttg
gtcctctcaggggaatattctattggacaagtactcactgtattcttttctgtattaatt
ggggcttttagtgttggacaggcatctccaagcattgaagcatttgcaaatgcaagagga
gcagcttatgaaatcttcaagataattgataataagccaagtattgacagctattcgaag
agtgggcacaaaccagataatattaagggaaatttggaattcagaaatgttcacttcagt
tacccatctcgaaaagaagttaagatcttgaagggtctgaacctgaaggtgcagagtggg
cagacggtggccctggttggaaacagtggctgtgggaagagcacaacagtccagctgatg
cagaggctctatgaccccacagaggggatggtcagtgttgatggacaggatattaggacc
ataaatgtaaggtttctacgggaaatcattggtgtggtgagtcaggaacctgtattgttt
gccaccacgatagctgaaaacattcgctatggccgtgaaaatgtcaccatggatgagatt
gagaaagctgtcaaggaagccaatgcctatgactttatcatgaaactgcctcataaattt
gacaccctggttggagagagaggggcccagttgagtggtgggcagaagcagaggatcgcc
attgcacgtgccctggttcgcaaccccaagatcctcctgctggatgaggccacgtcagcc
ttggacacagaaagcgaagcagtggttcaggtggctctggataaggccagaaaaggtcgg
accaccattgtgatagctcatcgtttgtctacagttcgtaatgctgacgtcatcgctggt
ttcgatgatggagtcattgtggagaaaggaaatcatgatgaactcatgaaagagaaaggc
atttacttcaaacttgtcacaatgcagacagcaggaaatgaagttgaattagaaaatgca
gctgatgaatccaaaagtgaaattgatgccttggaaatgtcttcaaatgattcaagatcc
agtctaataagaaaaagatcaactcgtaggagtgtccgtggatcacaagcccaagacaga
aagcttagtaccaaagaggctctggatgaaagtatacctccagtttccttttggaggatt
atgaagctaaatttaactgaatggccttattttgttgttggtgtattttgtgccattata
aatggaggcctgcaaccagcatttgcaataatattttcaaagattataggggtttttaca
agaattgatgatcctgaaacaaaacgacagaatagtaacttgttttcactattgtttcta
gcccttggaattatttcttttattacatttttccttcagggtttcacatttggcaaagct
ggagagatcctcaccaagcggctccgatacatggttttccgatccatgctcagacaggat
gtgagttggtttgatgaccctaaaaacaccactggagcattgactaccaggctcgccaat
gatgctgctcaagttaaaggggctataggttccaggcttgctgtaattacccagaatata
gcaaatcttgggacaggaataattatatccttcatctatggttggcaactaacactgtta
ctcttagcaattgtacccatcattgcaatagcaggagttgttgaaatgaaaatgttgtct
ggacaagcactgaaagataagaaagaactagaaggttctgggaagatcgctactgaagca
atagaaaacttccgaaccgttgtttctttgactcaggagcagaagtttgaacatatgtat
gctcagagtttgcaggtaccatacagaaactctttgaggaaagcacacatctttggaatt
acattttccttcacccaggcaatgatgtatttttcctatgctggatgtttccggtttgga
gcctacttggtggcacataaactcatgagctttgaggatgttctgttagtattttcagct
gttgtctttggtgccatggccgtggggcaagtcagttcatttgctcctgactatgccaaa
gccaaaatatcagcagcccacatcatcatgatcattgaaaaaacccctttgattgacagc
tacagcacggaaggcctaatgccgaacacattggaaggaaatgtcacatttggtgaagtt
gtattcaactatcccacccgaccggacatcccagtgcttcagggactgagcctggaggtg
aagaagggccagacgctggctctggtgggcagcagtggctgtgggaagagcacagtggtc
cagctcctggagcggttctacgaccccttggcagggaaagtgctgcttgatggcaaagaa
ataaagcgactgaatgttcagtggctccgagcacacctgggcatcgtgtcccaggagccc
atcctgtttgactgcagcattgctgagaacattgcctatggagacaacagccgggtggtg
tcacaggaagagattgtgagggcagcaaaggaggccaacatacatgccttcatcgagtca
ctgcctaataaatatagcactaaagtaggagacaaaggaactcagctctctggtggccag
aaacaacgcattgccatagctcgtgcccttgttagacagcctcatattttgcttttggat
gaagccacgtcagctctggatacagaaagtgaaaaggttgtccaagaagccctggacaaa
gccagagaaggccgcacctgcattgtgattgctcaccgcctgtccaccatccagaatgca
gacttaatagtggtgtttcagaatggcagagtcaaggagcatggcacgcatcagcagctg
ctggcacagaaaggcatctatttttcaatggtcagtgtccaggctggaacaaagcgccag
tga

DBGET integrated database retrieval system