KEGG   Homo sapiens (human): 4589
Entry
4589              CDS       T01001                                 

Gene name
MUC7, MG2
Definition
(RefSeq) mucin 7, secreted
  KO
K13909  mucin-7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    4589 (MUC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4589 (MUC7)
Membrane trafficking [BR:hsa04131]
 Others
  Mucins
   Secretory mucins
    4589 (MUC7)
SSDB
Other DBs
NCBI-GeneID: 4589
NCBI-ProteinID: NP_001138478
OMIM: 158375
HGNC: 7518
Ensembl: ENSG00000171195
Vega: OTTHUMG00000129916
Pharos: Q8TAX7(Tbio)
UniProt: Q8TAX7
LinkDB
Position
4q13.3
AA seq 377 aa
MKTLPLFVCICALSACFSFSEGRERDHELRHRRHHHQSPKSHFELPHYPGLLAHQKPFIR
KSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSAS
TKITTLPNVTFLPQNATTISSRENVNTSSSVATLAPVNSPAPQDTTAAPPTPSATTPAPP
SSSAPPETTAAPPTPSATTQAPPSSSAPPETTAAPPTPPATTPAPPSSSAPPETTAAPPT
PSATTPAPLSSSAPPETTAVPPTPSATTLDPSSASAPPETTAAPPTPSATTPAPPSSPAP
QETTAAPITTPNSSPTTLAPDTSETSAAPTHQTTTSVTTQTTTTKQPTSAPGQNKISRFL
LYMKNLLNRIIDDMVEQ
NT seq 1134 nt   +upstreamnt  +downstreamnt
atgaaaactctgccgctgtttgtgtgcatctgtgcactgagtgcttgcttctcgttcagt
gaaggtcgagaaagggatcatgaactacgtcacagaaggcatcatcaccaatcacccaaa
tctcactttgaattaccacattatcctggactgctagctcaccagaagccgttcattaga
aagtcctataaatgtctgcacaaacgctgtaggcctaagcttccaccttcacctaataac
ccccccaaattcccaaatcctcaccagccacctaaacatccagataaaaatagcagtgtg
gtcaaccctaccttagtggctacaacccaaattccatctgtgactttcccatcagcttcc
accaaaattactacccttccaaatgtgacttttcttccccagaatgccaccaccatatct
tcaagagaaaatgttaacacaagctcttctgtagctacattagcaccagtgaattcccca
gctccacaagacaccacagctgccccacccacaccttctgcaactacaccagctccacca
tcttcctcagctccaccagagaccacagctgccccacccacaccttctgcaactacacaa
gctccaccatcttcctcagctccaccagagaccacagctgccccacccacacctcctgca
actacaccagctccaccatcttcctcagctccaccagagaccacagctgccccacccaca
ccttctgcaactacaccagctccactatcttcctcagctccaccagagaccacagctgtc
ccacccacaccttctgcaactaccctagacccatcatccgcctcagctccaccagagacc
acagctgccccacccacaccttctgcaactacaccagctccaccgtcttccccagctcca
caagagaccacagctgccccaattaccacacctaattcttccccaactactcttgcacct
gacacttctgaaacttcagctgcacccacacaccagactactacttcggtcactactcaa
actactactactaaacaaccaacttcagctcctggccaaaataaaatttctcgatttctt
ttatatatgaagaatctactaaacagaattattgacgacatggtggagcaatag

DBGET integrated database retrieval system