KEGG   Homo sapiens (human): 4597
Entry
4597              CDS       T01001                                 

Gene name
MVD, FP17780, MDDase, MPD, POROK7
Definition
(RefSeq) mevalonate diphosphate decarboxylase
  KO
K01597  diphosphomevalonate decarboxylase [EC:4.1.1.33]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00900  Terpenoid backbone biosynthesis
hsa01100  Metabolic pathways
Module
hsa_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Disease
H01933  Porokeratosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    4597 (MVD)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.33  diphosphomevalonate decarboxylase
     4597 (MVD)
SSDB
Motif
Pfam: MDD_C GHMP_kinases_N
Other DBs
NCBI-GeneID: 4597
NCBI-ProteinID: NP_002452
OMIM: 603236
HGNC: 7529
Ensembl: ENSG00000167508
Vega: OTTHUMG00000137865
Pharos: P53602(Tchem)
UniProt: P53602
LinkDB
Structure
PDB: 
3D4J

Position
16q24.2
AA seq 400 aa
MASEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDF
TEDRIWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPT
AAGLASSAAGYACLAYTLARVYGVESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKD
SIARQVAPESHWPELRVLILVVSAEKKLTGSTVGMRASVETSPLLRFRAESVVPARMAEM
ARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAISWRIIHLVHRFNAHHGDTKV
AYTFDAGPNAVIFTLDDTVAEFVAAVWHGFPPGSNGDTFLKGLQVRPAPLSAELQAALAM
EPTPGGVKYIIVTQVGPGPQILDDPCAHLLGPDGLPKPAA
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggcctcggagaagccgctggcggcagtcacttgtacagcgccggtcaacatcgcggtc
atcaagtactggggcaagcgcgatgaagagctggttctgcccatcaactcctccctgagc
gtcactctgcaccaggaccagttaaaaaccaccacaacagccgtcatcagcaaggacttc
accgaggaccggatttggctgaatggccgggaggaggatgtggggcagccgcggctgcag
gcctgcctgcgggagatccgctgcctggcccggaagcggaggaactcacgggatggggac
ccgctgccctccagcctcagctgcaaggtgcacgtggcatcggtgaacaacttccccacg
gctgcgggcctggcctcctcagcggcgggctatgcctgcctagcctacaccctggcccgt
gtctacggcgtggagagtgacctctcagaagtggctcgccggggctcaggcagcgcctgc
cggagcctgtatgggggctttgtggagtggcagatgggagagcaggccgacgggaaggac
agcatcgctcggcaagtggcccccgagtcacactggcctgaactccgcgtgctcatcctt
gtggtgagcgctgagaagaagctgacaggcagtaccgtgggcatgcgggccagtgtggag
accagccccctgcttcggttccgggccgagtccgtggtgcccgcgcgcatggcggagatg
gcccgctgcatccgggagcgagacttccccagcttcgcccagctgaccatgaaggacagc
aaccagttccacgccacctgcctcgacaccttcccgcccatctcttacctcaatgccatc
tcctggcgcatcatccacctggtgcaccgcttcaacgcccaccacggggacaccaaggtg
gcgtacacctttgacgcgggccccaatgccgtgatcttcaccctggacgacactgtggct
gagtttgtggctgctgtgtggcacggctttcccccaggctcgaatggagacacgtttctg
aaggggctgcaggtgaggccggcccctctctcagctgagcttcaggctgcgctggccatg
gagccgacccccggtggggtcaaatacatcattgtcactcaggtggggccagggcctcaa
atcctggatgacccctgcgcccacctcctgggtcctgacggcctgccgaagccagctgcc
tga

DBGET integrated database retrieval system