KEGG   Homo sapiens (human): 4599Help
Entry
4599              CDS       T01001                                 

Gene name
MX1, IFI-78K, IFI78, MX, MxA
Definition
(RefSeq) MX dynamin like GTPase 1
  KO
K14754  interferon-induced GTP-binding protein Mx1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
Network
nt06122  IFN signaling (virus)
nt06163  Hepatitis C virus (HCV)
nt06166  Human papillomavirus (HPV)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
nt06222  IFN signaling
nt06263  Hepatocellular carcinoma
  Element
N00270  HCV Core to IFN signaling pathway
N00377  HPV E6 to IFN signaling pathway
N00378  HPV E6 to IFN signaling pathway
N00379  HPV E7 to IFN signaling pathway
N00693  MV V/P to IFN signaling pathway
N00694  MV V/P/C to IFN signaling pathway
N00738  IAV NS1 to IFN signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    4599 (MX1)
   05164 Influenza A
    4599 (MX1)
   05160 Hepatitis C
    4599 (MX1)
   05165 Human papillomavirus infection
    4599 (MX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_21 DUF2120 AAA_29 AAA_16 Ago_PAZ ABC_tran PP_kinase_N
Motif
Other DBs
NCBI-GeneID: 4599
NCBI-ProteinID: NP_001138397
OMIM: 147150
HGNC: 7532
Ensembl: ENSG00000157601
Vega: OTTHUMG00000086755
Pharos: P20591(Tbio)
UniProt: P20591
LinkDB All DBs
Structure
PDB: 

Position
21q22.3
AA seq 662 aa AA seqDB search
MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLR
ALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKW
RGKVSYQDYEIEISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLP
GITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGD
RTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREK
IFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETHQRITEELQKY
GVDIPEDENEKMFFLIDKVNAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIEN
NFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMV
RLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRG
ALQKVREKELEEEKKKKSWDFGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLII
QFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQF
PG
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggttgtttccgaagtggacatcgcaaaagctgatccagctgctgcatcccaccctcta
ttactgaatggagatgctactgtggcccagaaaaatccaggctcggtggctgagaacaac
ctgtgcagccagtatgaggagaaggtgcgcccctgcatcgacctcattgactccctgcgg
gctctaggtgtggagcaggacctggccctgccagccatcgccgtcatcggggaccagagc
tcgggcaagagctccgtgttggaggcactgtcaggagttgcccttcccagaggcagcggg
atcgtgaccagatgcccgctggtgctgaaactgaagaaacttgtgaacgaagataagtgg
agaggcaaggtcagttaccaggactacgagattgagatttcggatgcttcagaggtagaa
aaggaaattaataaagcccagaatgccatcgccggggaaggaatgggaatcagtcatgag
ctaatcaccctggagatcagctcccgagatgtcccggatctgactctaatagaccttcct
ggcataaccagagtggctgtgggcaatcagcctgctgacattgggtataagatcaagaca
ctcatcaagaagtacatccagaggcaggagacaatcagcctggtggtggtccccagtaat
gtggacatcgccaccacagaggctctcagcatggcccaggaggtggaccccgagggagac
aggaccatcggaatcttgacgaagcctgatctggtggacaaaggaactgaagacaaggtt
gtggacgtggtgcggaacctcgtgttccacctgaagaagggttacatgattgtcaagtgc
cggggccagcaggagatccaggaccagctgagcctgtccgaagccctgcagagagagaag
atcttctttgagaaccacccatatttcagggatctgctggaggaaggaaaggccacggtt
ccctgcctggcagaaaaacttaccagcgagctcatcacacatatctgtaaatctctgccc
ctgttagaaaatcaaatcaaggagactcaccagagaataacagaggagctacaaaagtat
ggtgtcgacataccggaagacgaaaatgaaaaaatgttcttcctgatagataaagttaat
gcctttaatcaggacatcactgctctcatgcaaggagaggaaactgtaggggaggaagac
attcggctgtttaccagactccgacacgagttccacaaatggagtacaataattgaaaac
aattttcaagaaggccataaaattttgagtagaaaaatccagaaatttgaaaatcagtat
cgtggtagagagctgccaggctttgtgaattacaggacatttgagacaatcgtgaaacag
caaatcaaggcactggaagagccggctgtggatatgctacacaccgtgacggatatggtc
cggcttgctttcacagatgtttcgataaaaaattttgaagagttttttaacctccacaga
accgccaagtccaaaattgaagacattagagcagaacaagagagagaaggtgagaagctg
atccgcctccacttccagatggaacagattgtctactgccaggaccaggtatacaggggt
gcattgcagaaggtcagagagaaggagctggaagaagaaaagaagaagaaatcctgggat
tttggggctttccagtccagctcggcaacagactcttccatggaggagatctttcagcac
ctgatggcctatcaccaggaggccagcaagcgcatctccagccacatccctttgatcatc
cagttcttcatgctccagacgtacggccagcagcttcagaaggccatgctgcagctcctg
caggacaaggacacctacagctggctcctgaaggagcggagcgacaccagcgacaagcgg
aagttcctgaaggagcggcttgcacggctgacgcaggctcggcgccggcttgcccagttc
cccggttaa

DBGET integrated database retrieval system