KEGG   Homo sapiens (human): 4599
Entry
4599              CDS       T01001                                 

Gene name
MX1, IFI-78K, IFI78, MX, MxA, lncMX1-215
Definition
(RefSeq) MX dynamin like GTPase 1
  KO
K14754  interferon-induced GTP-binding protein Mx
Organism
hsa  Homo sapiens (human)
Pathway
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    4599 (MX1)
   05171 Coronavirus disease - COVID-19
    4599 (MX1)
   05164 Influenza A
    4599 (MX1)
   05162 Measles
    4599 (MX1)
   05165 Human papillomavirus infection
    4599 (MX1)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_21 DUF2120 AAA_29 AAA_16 Ago_PAZ ABC_tran Perilipin
Other DBs
NCBI-GeneID: 4599
NCBI-ProteinID: NP_001138397
OMIM: 147150
HGNC: 7532
Ensembl: ENSG00000157601
Vega: OTTHUMG00000086755
Pharos: P20591(Tbio)
UniProt: P20591
LinkDB
Structure
PDB: 

Position
21q22.3
AA seq 662 aa
MVVSEVDIAKADPAAASHPLLLNGDATVAQKNPGSVAENNLCSQYEEKVRPCIDLIDSLR
ALGVEQDLALPAIAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKLVNEDKW
RGKVSYQDYEIEISDASEVEKEINKAQNAIAGEGMGISHELITLEISSRDVPDLTLIDLP
GITRVAVGNQPADIGYKIKTLIKKYIQRQETISLVVVPSNVDIATTEALSMAQEVDPEGD
RTIGILTKPDLVDKGTEDKVVDVVRNLVFHLKKGYMIVKCRGQQEIQDQLSLSEALQREK
IFFENHPYFRDLLEEGKATVPCLAEKLTSELITHICKSLPLLENQIKETHQRITEELQKY
GVDIPEDENEKMFFLIDKVNAFNQDITALMQGEETVGEEDIRLFTRLRHEFHKWSTIIEN
NFQEGHKILSRKIQKFENQYRGRELPGFVNYRTFETIVKQQIKALEEPAVDMLHTVTDMV
RLAFTDVSIKNFEEFFNLHRTAKSKIEDIRAEQEREGEKLIRLHFQMEQIVYCQDQVYRG
ALQKVREKELEEEKKKKSWDFGAFQSSSATDSSMEEIFQHLMAYHQEASKRISSHIPLII
QFFMLQTYGQQLQKAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQF
PG
NT seq 1989 nt   +upstreamnt  +downstreamnt
atggttgtttccgaagtggacatcgcaaaagctgatccagctgctgcatcccaccctcta
ttactgaatggagatgctactgtggcccagaaaaatccaggctcggtggctgagaacaac
ctgtgcagccagtatgaggagaaggtgcgcccctgcatcgacctcattgactccctgcgg
gctctaggtgtggagcaggacctggccctgccagccatcgccgtcatcggggaccagagc
tcgggcaagagctccgtgttggaggcactgtcaggagttgcccttcccagaggcagcggg
atcgtgaccagatgcccgctggtgctgaaactgaagaaacttgtgaacgaagataagtgg
agaggcaaggtcagttaccaggactacgagattgagatttcggatgcttcagaggtagaa
aaggaaattaataaagcccagaatgccatcgccggggaaggaatgggaatcagtcatgag
ctaatcaccctggagatcagctcccgagatgtcccggatctgactctaatagaccttcct
ggcataaccagagtggctgtgggcaatcagcctgctgacattgggtataagatcaagaca
ctcatcaagaagtacatccagaggcaggagacaatcagcctggtggtggtccccagtaat
gtggacatcgccaccacagaggctctcagcatggcccaggaggtggaccccgagggagac
aggaccatcggaatcttgacgaagcctgatctggtggacaaaggaactgaagacaaggtt
gtggacgtggtgcggaacctcgtgttccacctgaagaagggttacatgattgtcaagtgc
cggggccagcaggagatccaggaccagctgagcctgtccgaagccctgcagagagagaag
atcttctttgagaaccacccatatttcagggatctgctggaggaaggaaaggccacggtt
ccctgcctggcagaaaaacttaccagcgagctcatcacacatatctgtaaatctctgccc
ctgttagaaaatcaaatcaaggagactcaccagagaataacagaggagctacaaaagtat
ggtgtcgacataccggaagacgaaaatgaaaaaatgttcttcctgatagataaagttaat
gcctttaatcaggacatcactgctctcatgcaaggagaggaaactgtaggggaggaagac
attcggctgtttaccagactccgacacgagttccacaaatggagtacaataattgaaaac
aattttcaagaaggccataaaattttgagtagaaaaatccagaaatttgaaaatcagtat
cgtggtagagagctgccaggctttgtgaattacaggacatttgagacaatcgtgaaacag
caaatcaaggcactggaagagccggctgtggatatgctacacaccgtgacggatatggtc
cggcttgctttcacagatgtttcgataaaaaattttgaagagttttttaacctccacaga
accgccaagtccaaaattgaagacattagagcagaacaagagagagaaggtgagaagctg
atccgcctccacttccagatggaacagattgtctactgccaggaccaggtatacaggggt
gcattgcagaaggtcagagagaaggagctggaagaagaaaagaagaagaaatcctgggat
tttggggctttccagtccagctcggcaacagactcttccatggaggagatctttcagcac
ctgatggcctatcaccaggaggccagcaagcgcatctccagccacatccctttgatcatc
cagttcttcatgctccagacgtacggccagcagcttcagaaggccatgctgcagctcctg
caggacaaggacacctacagctggctcctgaaggagcggagcgacaccagcgacaagcgg
aagttcctgaaggagcggcttgcacggctgacgcaggctcggcgccggcttgcccagttc
cccggttaa

KEGG   Homo sapiens (human): 4600
Entry
4600              CDS       T01001                                 

Gene name
MX2, MXB
Definition
(RefSeq) MX dynamin like GTPase 2
  KO
K14754  interferon-induced GTP-binding protein Mx
Organism
hsa  Homo sapiens (human)
Pathway
hsa05160  Hepatitis C
hsa05162  Measles
hsa05164  Influenza A
hsa05165  Human papillomavirus infection
hsa05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    4600 (MX2)
   05171 Coronavirus disease - COVID-19
    4600 (MX2)
   05164 Influenza A
    4600 (MX2)
   05162 Measles
    4600 (MX2)
   05165 Human papillomavirus infection
    4600 (MX2)
SSDB
Motif
Pfam: Dynamin_M Dynamin_N GED MMR_HSR1 AAA_21 ABC_tran AAA_16 AAA_29
Other DBs
NCBI-GeneID: 4600
NCBI-ProteinID: NP_002454
OMIM: 147890
HGNC: 7533
Ensembl: ENSG00000183486
Vega: OTTHUMG00000086753
Pharos: P20592(Tbio)
UniProt: P20592
LinkDB
Structure
PDB: 
4X0R 4WHJ

Position
21q22.3
AA seq 715 aa
MSKAHKPWPYRRRSQFSSRKYLKKEMNSFQQQPPPFGTVPPQMMFPPNWQGAEKDAAFLA
KDFNFLTLNNQPPPGNRSQPRAMGPENNLYSQYEQKVRPCIDLIDSLRALGVEQDLALPA
IAVIGDQSSGKSSVLEALSGVALPRGSGIVTRCPLVLKLKKQPCEAWAGRISYRNTELEL
QDPGQVEKEIHKAQNVMAGNGRGISHELISLEITSPEVPDLTIIDLPGITRVAVDNQPRD
IGLQIKALIKKYIQRQQTINLVVVPCNVDIATTEALSMAHEVDPEGDRTIGILTKPDLMD
RGTEKSVMNVVRNLTYPLKKGYMIVKCRGQQEITNRLSLAEATKKEITFFQTHPYFRVLL
EEGSATVPRLAERLTTELIMHIQKSLPLLEGQIRESHQKATEELRRCGADIPSQEADKMF
FLIEKIKMFNQDIEKLVEGEEVVRENETRLYNKIREDFKNWVGILATNTQKVKNIIHEEV
EKYEKQYRGKELLGFVNYKTFEIIVHQYIQQLVEPALSMLQKAMEIIQQAFINVAKKHFG
EFFNLNQTVQSTIEDIKVKHTAKAENMIQLQFRMEQMVFCQDQIYSVVLKKVREEIFNPL
GTPSQNMKLNSHFPSNESSVSSFTEIGIHLNAYFLETSKRLANQIPFIIQYFMLRENGDS
LQKAMMQILQEKNRYSWLLQEQSETATKRRILKERIYRLTQARHALCQFSSKEIH
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgtctaaggcccacaagccttggccctaccggaggagaagtcaattttcttctcgaaaa
tacctgaaaaaagaaatgaattccttccagcaacagccaccgccattcggcacagtgcca
ccacaaatgatgtttcctccaaactggcagggggcagagaaggacgctgctttcctcgcc
aaggacttcaactttctcactttgaacaatcagccaccaccaggaaacaggagccaacca
agggcaatggggcccgagaacaacctgtacagccagtacgagcagaaggtgcgcccctgc
attgacctcatcgactccctgcgggctctgggtgtggagcaggacctggccctgccagcc
atcgccgtcatcggggaccagagctcgggcaagagctctgtgctggaggcactgtcagga
gtcgcgcttcccagaggcagcggaatcgtaaccaggtgtccgctggtgctgaaactgaaa
aagcagccctgtgaggcatgggccggaaggatcagctaccggaacaccgagctagagctt
caggaccctggccaggtggagaaagagatacacaaagcccagaacgtcatggccgggaat
ggccggggcatcagccatgagctcatcagcctggagatcacctcccctgaggttccagac
ctgaccatcattgaccttcccggcatcaccagggtggctgtggacaaccagccccgagac
atcggactgcagatcaaggctctcatcaagaagtacatccagaggcagcagacgatcaac
ttggtggtggttccctgtaacgtggacattgccaccacggaggcgctgagcatggcccat
gaggtggacccggaaggggacaggaccatcggtatcctgaccaaaccagatctaatggac
aggggcactgagaaaagcgtcatgaatgtggtgcggaacctcacgtaccccctcaagaag
ggctacatgattgtgaagtgccggggccagcaggagatcacaaacaggctgagcttggca
gaggcaaccaagaaagaaattacattctttcaaacacatccatatttcagagttctcctg
gaggaggggtcagccacggttccccgactggcagaaagacttaccactgaactcatcatg
catatccaaaaatcgctcccgttgttagaaggacaaataagggagagccaccagaaggcg
accgaggagctgcggcgttgcggggctgacatccccagccaggaggccgacaagatgttc
tttctaattgagaaaatcaagatgtttaatcaggacatcgaaaagttagtagaaggagaa
gaagttgtaagggagaatgagacccgtttatacaacaaaatcagagaggattttaaaaac
tgggtaggcatacttgcaactaatacccaaaaagttaaaaatattatccacgaagaagtt
gaaaaatatgaaaagcagtatcgaggcaaggagcttctgggatttgtcaactacaagaca
tttgagatcatcgtgcatcagtacatccagcagctggtggagcccgcccttagcatgctc
cagaaagccatggaaattatccagcaagctttcattaacgtggccaaaaaacattttggc
gaatttttcaaccttaaccaaactgttcagagcacgattgaagacataaaagtgaaacac
acagcaaaggcagaaaacatgatccaacttcagttcagaatggagcagatggttttttgt
caagatcagatttacagtgttgttctgaagaaagtccgagaagagatttttaaccctctg
gggacgccttcacagaatatgaagttgaactctcattttcccagtaatgagtcttcggtt
tcctcctttactgaaataggcatccacctgaatgcctacttcttggaaaccagcaaacgt
ctcgccaaccagatcccatttataattcagtattttatgctccgagagaatggtgactcc
ttgcagaaagccatgatgcagatactacaggaaaaaaatcgctattcctggctgcttcaa
gagcagagtgagaccgctaccaagagaagaatccttaaggagagaatttaccggctcact
caggcgcgacacgcactctgtcaattctccagcaaagagatccactga

DBGET integrated database retrieval system