KEGG   Homo sapiens (human): 4605Help
Entry
4605              CDS       T01001                                 

Gene name
MYBL2, B-MYB, BMYB
Definition
(RefSeq) MYB proto-oncogene like 2
  KO
K21769  myb-related protein B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    4605 (MYBL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4605 (MYBL2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    4605 (MYBL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cmyb_C Myb_DNA-binding Myb_DNA-bind_6 Myb_DNA-bind_7 SLIDE Spore_III_AB Atg29_N DUF1917
Motif
Other DBs
NCBI-GeneID: 4605
NCBI-ProteinID: NP_002457
OMIM: 601415
HGNC: 7548
Ensembl: ENSG00000101057
Vega: OTTHUMG00000033062
Pharos: P10244(Tbio)
UniProt: P10244
LinkDB All DBs
Structure
PDB: 

Position
20q13.12
AA seq 700 aa AA seqDB search
MSRRTRCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWKFLASH
FPNRTDQQCQYRWLRVLNPDLVKGPWTKEEDQKVIELVKKYGTKQWTLIAKHLKGRLGKQ
CRERWHNHLNPEVKKSCWTEEEDRIICEAHKVLGNRWAEIAKMLPGRTDNAVKNHWNSTI
KRKVDTGGFLSESKDCKPPVYLLLELEDKDGLQSAQPTEGQGSLLTNWPSVPPTIKEEEN
SEEELAAATTSKEQEPIGTDLDAVRTPEPLEEFPKREDQEGSPPETSLPYKWVVEAANLL
IPAVGSSLSEALDLIESDPDAWCDLSKFDLPEEPSAEDSINNSLVQLQASHQQQVLPPRQ
PSALVPSVTEYRLDGHTISDLSRSSRGELIPISPSTEVGGSGIGTPPSVLKRQRKRRVAL
SPVTENSTSLSFLDSCNSLTPKSTPVKTLPFSPSQFLNFWNKQDTLELESPSLTSTPVCS
QKVVVTTPLHRDKTPLHQKHAAFVTPDQKYSMDNTPHTPTPFKNALEKYGPLKPLPQTPH
LEEDLKEVLRSEAGIELIIEDDIRPEKQKRKPGLRRSPIKKVRKSLALDIVDEDVKLMMS
TLPKSLSLPTTAPSNSSSLTLSGIKEDNSLLNQGFLQAKPEKAAVAQKPRSHFTTPAPMS
SAWKTVACGGTRDQLFMQEKARQLLGRLKPSHTSRTLILS
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgtctcggcggacgcgctgcgaggatctggatgagctgcactaccaggacacagattca
gatgtgccggagcagagggatagcaagtgcaaggtcaaatggacccatgaggaggacgag
cagctgagggccctggtgaggcagtttggacagcaggactggaagttcctggccagccac
ttccctaaccgcactgaccagcaatgccagtacaggtggctgagagttttgaatccagac
cttgtcaaggggccatggaccaaagaggaagaccaaaaagtcatcgagctggttaagaag
tatggcacaaagcagtggacactgattgccaagcacctgaagggccggctggggaagcag
tgccgtgaacgctggcacaaccacctcaaccctgaggtgaagaagtcttgctggaccgag
gaggaggaccgcatcatctgcgaggcccacaaggtgctgggcaaccgctgggccgagatc
gccaagatgttgccagggaggacagacaatgctgtgaagaatcactggaactctaccatc
aaaaggaaggtggacacaggaggcttcttgagcgagtccaaagactgcaagcccccagtg
tacttgctgctggagctcgaggacaaggacggcctccagagtgcccagcccacggaaggc
cagggaagtcttctgaccaactggccctccgtccctcctaccataaaggaggaggaaaac
agtgaggaggaacttgcagcagccaccacatcgaaggaacaggagcccatcggtacagat
ctggacgcagtgcgaacaccagagcccttggaggaattcccgaagcgtgaggaccaggaa
ggctccccaccagaaacgagcctgccttacaagtgggtggtggaggcagctaacctcctc
atccctgctgtgggttctagcctctctgaagccctggacttgatcgagtcggaccctgat
gcttggtgtgacctgagtaaatttgacctccctgaggaaccatctgcagaggacagtatc
aacaacagcctagtgcagctgcaagcgtcacatcagcagcaagtcctgccaccccgccag
ccttccgccctggtgcccagtgtgaccgagtaccgcctggatggccacaccatctcagac
ctgagccggagcagccggggcgagctgatccccatctcccccagcactgaagtcgggggc
tctggcattggcacaccgccctctgtgctcaagcggcagaggaagaggcgtgtggctctg
tcccctgtcactgagaatagcaccagtctgtccttcctggattcctgtaacagcctcacg
cccaagagcacacctgttaagaccctgcccttctcgccctcccagtttctgaacttctgg
aacaaacaggacacattggagctggagagcccctcgctgacatccaccccagtgtgcagc
cagaaggtggtggtcaccacaccactgcaccgggacaagacacccctgcaccagaaacat
gctgcgtttgtaaccccagatcagaagtactccatggacaacactccccacacgccaacc
ccgttcaagaacgccctggagaagtacggacccctgaagcccctgccacagaccccgcac
ctggaggaggacttgaaggaggtgctgcgttctgaggctggcatcgaactcatcatcgag
gacgacatcaggcccgagaagcagaagaggaagcctgggctgcggcggagccccatcaag
aaagtccggaagtctctggctcttgacattgtggatgaggatgtgaagctgatgatgtcc
acactgcccaagtctctatccttgccgacaactgccccttcaaactcttccagcctcacc
ctgtcaggtatcaaagaagacaacagcttgctcaaccagggcttcttgcaggccaagccc
gagaaggcagcagtggcccagaagccccgaagccacttcacgacacctgcccctatgtcc
agtgcctggaagacggtggcctgcggggggaccagggaccagcttttcatgcaggagaaa
gcccggcagctcctgggccgcctgaagcccagccacacatctcggaccctcatcttgtcc
tga

DBGET integrated database retrieval system