KEGG   Homo sapiens (human): 4633
Entry
4633              CDS       T01001                                 

Gene name
MYL2, CMH10, MLC-2s/v, MLC2
Definition
(RefSeq) myosin light chain 2
  KO
K10351  myosin regulatory light chain 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04371  Apelin signaling pathway
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05131  Shigellosis
hsa05132  Salmonella infection
hsa05410  Hypertrophic cardiomyopathy
hsa05414  Dilated cardiomyopathy
Network
nt06135  Cytoskeletal regulation (viruses)
  Element
N01074  Shigella IpaA to ITGA/B-RhoGEF-RhoA signaling pathway
N01130  Salmonella SopB to RhoA signaling pathway
Disease
H00292  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    4633 (MYL2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    4633 (MYL2)
   04530 Tight junction
    4633 (MYL2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    4633 (MYL2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    4633 (MYL2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    4633 (MYL2)
   04261 Adrenergic signaling in cardiomyocytes
    4633 (MYL2)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    4633 (MYL2)
   05414 Dilated cardiomyopathy
    4633 (MYL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    4633 (MYL2)
   05131 Shigellosis
    4633 (MYL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    4633 (MYL2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4633 (MYL2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5
Other DBs
NCBI-GeneID: 4633
NCBI-ProteinID: NP_000423
OMIM: 160781
HGNC: 7583
Ensembl: ENSG00000111245
Vega: OTTHUMG00000169535
Pharos: P10916(Tbio)
UniProt: P10916 Q6IB42
LinkDB
Structure
PDB: 
5TBY

Position
12q24.11
AA seq 166 aa
MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVR
EMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcacctaagaaagcaaagaagagagccgggggcgccaactccaacgtgttctccatg
ttcgaacagacccaaatccaggaatttaaggaggccttcactatcatggaccagaacagg
gatggcttcattgacaagaacgatctgagagacacctttgctgcccttgggcgagtgaac
gtgaaaaatgaagaaattgatgaaatgatcaaggaggctccgggtccaattaactttact
gtgttcctcacaatgtttggggagaaacttaagggagcggaccctgaggaaaccattctc
aacgcattcaaagtgtttgaccctgaaggcaaaggggtgctgaaggctgattacgttcgg
gaaatgctgaccacgcaggcggagaggttttccaaggaggaggttgaccagatgttcgcc
gccttcccccctgacgtgactggcaacttggactacaagaacctggtgcacatcatcacc
cacggagaagagaaggactag

DBGET integrated database retrieval system