KEGG   Homo sapiens (human): 4633Help
Entry
4633              CDS       T01001                                 

Gene name
MYL2, CMH10, MLC-2s/v, MLC2
Definition
(RefSeq) myosin light chain 2
  KO
K10351  myosin regulatory light chain 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04371  Apelin signaling pathway
hsa04510  Focal adhesion
hsa04530  Tight junction
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
Disease
H00292  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    4633 (MYL2)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    4633 (MYL2)
   04530 Tight junction
    4633 (MYL2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    4633 (MYL2)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    4633 (MYL2)
  Circulatory system
   04260 Cardiac muscle contraction
    4633 (MYL2)
   04261 Adrenergic signaling in cardiomyocytes
    4633 (MYL2)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    4633 (MYL2)
   05414 Dilated cardiomyopathy (DCM)
    4633 (MYL2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4633 (MYL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 4633
NCBI-ProteinID: NP_000423
OMIM: 160781
HGNC: 7583
Ensembl: ENSG00000111245
Vega: OTTHUMG00000169535
Pharos: P10916(Tbio)
UniProt: P10916 Q6IB42
LinkDB All DBs
Structure
PDB: 

Position
12q24.11
AA seq 166 aa AA seqDB search
MAPKKAKKRAGGANSNVFSMFEQTQIQEFKEAFTIMDQNRDGFIDKNDLRDTFAALGRVN
VKNEEIDEMIKEAPGPINFTVFLTMFGEKLKGADPEETILNAFKVFDPEGKGVLKADYVR
EMLTTQAERFSKEEVDQMFAAFPPDVTGNLDYKNLVHIITHGEEKD
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggcacctaagaaagcaaagaagagagccgggggcgccaactccaacgtgttctccatg
ttcgaacagacccaaatccaggaatttaaggaggccttcactatcatggaccagaacagg
gatggcttcattgacaagaacgatctgagagacacctttgctgcccttgggcgagtgaac
gtgaaaaatgaagaaattgatgaaatgatcaaggaggctccgggtccaattaactttact
gtgttcctcacaatgtttggggagaaacttaagggagcggaccctgaggaaaccattctc
aacgcattcaaagtgtttgaccctgaaggcaaaggggtgctgaaggctgattacgttcgg
gaaatgctgaccacgcaggcggagaggttttccaaggaggaggttgaccagatgttcgcc
gccttcccccctgacgtgactggcaacttggactacaagaacctggtgcacatcatcacc
cacggagaagagaaggactag

DBGET integrated database retrieval system