KEGG   Homo sapiens (human): 4634Help
Entry
4634              CDS       T01001                                 

Gene name
MYL3, CMH8, MLC-lV/sb, MLC1SB, MLC1V, VLC1, VLCl
Definition
(RefSeq) myosin light chain 3
  KO
K12749  myosin light chain 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04260  Cardiac muscle contraction
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04371  Apelin signaling pathway
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05414  Dilated cardiomyopathy (DCM)
Disease
H00292  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    4634 (MYL3)
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    4634 (MYL3)
   04261 Adrenergic signaling in cardiomyocytes
    4634 (MYL3)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    4634 (MYL3)
   05414 Dilated cardiomyopathy (DCM)
    4634 (MYL3)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     4634 (MYL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_6 EF-hand_1 EF-hand_7 DED
Motif
Other DBs
NCBI-GeneID: 4634
NCBI-ProteinID: NP_000249
OMIM: 160790
HGNC: 7584
Ensembl: ENSG00000160808
Vega: OTTHUMG00000133516
Pharos: P08590(Tbio)
UniProt: P08590 A0A024R2Q5
LinkDB All DBs
Structure
PDB: 

Position
3p21.31
AA seq 195 aa AA seqDB search
MAPKKPEPKKDDAKAAPKAAPAPAPPPEPERPKEVEFDASKIKIEFTPEQIEEFKEAFML
FDRTPKCEMKITYGQCGDVLRALGQNPTQAEVLRVLGKPRQEELNTKMMDFETFLPMLQH
ISKNKDTGTYEDFVEGLRVFDKEGNGTVMGAELRHVLATLGERLTEDEVEKLMAGQEDSN
GCINYEAFVKHIMSS
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggcccccaaaaagccagagcccaagaaggatgatgccaaggcagcccccaaggcagct
ccagctcccgcacctccccctgagcctgagcgccctaaggaggtcgagtttgatgcttcc
aagatcaagattgagttcacacctgagcagattgaagagttcaaggaagccttcatgctg
ttcgaccgcacacccaagtgtgagatgaagatcacctacgggcagtgtggggatgtcctg
cgggcgctgggccagaaccccacacaggcagaagtgctccgtgtcctggggaagccaaga
caggaagagctcaataccaagatgatggactttgaaactttcctgcctatgctccagcac
atttccaagaacaaggacacaggcacctatgaggacttcgtggaggggctgcgggtcttc
gacaaggagggcaatggcactgtcatgggtgctgagcttcgccacgtgctggccacgctg
ggtgagaggctgacagaagacgaagtggagaagttgatggctgggcaagaggactccaat
ggctgcatcaactatgaagcatttgtgaagcacatcatgtccagctaa

DBGET integrated database retrieval system