KEGG   Homo sapiens (human): 466
Entry
466               CDS       T01001                                 

Gene name
ATF1, EWS-ATF1, FUS/ATF-1, TREB36
Definition
(RefSeq) activating transcription factor 1
  KO
K09053  activating transcription factor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04925  Aldosterone synthesis and secretion
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00136  EWSR1-ATF1 fusion to transcriptional activation
Disease
H00052  Clear cell sarcoma of soft tissue
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    466 (ATF1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    466 (ATF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    466 (ATF1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    466 (ATF1)
SSDB
Motif
Pfam: bZIP_1 pKID bZIP_2 bZIP_Maf ASD2
Other DBs
NCBI-GeneID: 466
NCBI-ProteinID: NP_005162
OMIM: 123803
HGNC: 783
Ensembl: ENSG00000123268
Vega: OTTHUMG00000169482
Pharos: P18846(Tchem)
UniProt: P18846
LinkDB
Position
12q13.12
AA seq 271 aa
MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILAR
RPSYRKILKDLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQL
ASPGTDGVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQ
IRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKC
LENRVAVLENQNKTLIEELKTLKDLYSNKSV
NT seq 816 nt   +upstreamnt  +downstreamnt
atggaagattcccacaagagtaccacgtcagagacagcacctcaacctggttcagcagtt
cagggagctcacatttctcatattgctcaacaggtatcatctttatcagaaagtgaggag
tcccaggactcatccgacagcataggctcctcacagaaagcccacgggatcctagcacgg
cgcccatcttacagaaaaattttgaaagacttatcttctgaagatacacggggcagaaaa
ggagacggagaaaattctggagtttctgctgctgtcacttctatgtctgttccaactccc
atctatcagactagcagcggacagtacattgccattgccccaaatggagccttacagttg
gcaagtccaggcacagatggagtacagggacttcagacattaaccatgacaaattcaggc
agtactcagcaaggtacaactattcttcagtatgcacagacctctgatggacagcagata
cttgtgcccagcaatcaggtggtcgtacaaactgcatcaggagatatgcaaacatatcag
atccgaactacaccttcagctacttctctgccacaaactgtggtgatgacatctcctgtg
actctcacctctcagacaactaagacagatgacccccaattgaaaagagaaataaggtta
atgaaaaacagagaagctgctcgagaatgtcgcagaaagaagaaagaatatgtgaaatgc
ctggaaaaccgagttgcagtcctggaaaatcaaaataaaactctaatagaagagttaaaa
actttgaaggatctttattccaataaaagtgtttga

DBGET integrated database retrieval system