KEGG   Homo sapiens (human): 4684
Entry
4684              CDS       T01001                                 

Gene name
NCAM1, CD56, MSK39, NCAM
Definition
(RefSeq) neural cell adhesion molecule 1
  KO
K06491  neural cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa05020  Prion disease
Drug target
Lorvotuzumab mertansine: D09927
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    4684 (NCAM1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    4684 (NCAM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4684 (NCAM1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    4684 (NCAM1)
   04090 CD molecules [BR:hsa04090]
    4684 (NCAM1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    4684 (NCAM1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    4684 (NCAM1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    4684 (NCAM1)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  NCAM1/2
   4684 (NCAM1)
CD molecules [BR:hsa04090]
 Proteins
  4684 (NCAM1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Adhesion molecules of cell surface
   4684 (NCAM1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  4684 (NCAM1)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Ig_4 Ig_5 C1-set Ig_6 Adeno_E3_CR1 Herpes_gE Pur_ac_phosph_N Collagen_bind_2
Other DBs
NCBI-GeneID: 4684
NCBI-ProteinID: NP_851996
OMIM: 116930
HGNC: 7656
Ensembl: ENSG00000149294
Vega: OTTHUMG00000167196
Pharos: P13591(Tbio)
UniProt: P13591
LinkDB
Structure
PDB: 

Position
11q23.2
AA seq 858 aa
MLQTKDLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGE
KLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTGEDGSESEATVNVKIFQKLMF
KNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLSNNYLQIRGIK
KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTIQARQNIVNATANLGQSVTLVCDAEGF
PEPTMSWTKDGEQIEQEEDDEKYIFSDDSSQLTIKKVDKNDEAEYICIAENKAGEQDATI
HLKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPE
KQETLDGHMVVRSHARVSSLTLKSIQYTDAGEYICTASNTIGQDSQSMYLEVQYAPKLQG
PVAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDS
ENDFGNYNCTAVNRIGQESLEFILVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPI
LKYKAEWRAVGEEVWHSKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAA
SEFKTQPVQGEPSAPKLEGQMGEDGNSIKVNLIKQDDGGSPIRHYLVRYRALSSEWKPEI
RLPSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTSGLS
TGAIVGILIVIFVLLLVVVDITCYFLNKCGLFMCIAVNLCGKAGPGAKGKDMEEGKAAFS
KDESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPECQETETKPAPAE
VKTVPNDATQTKENESKA
NT seq 2577 nt   +upstreamnt  +downstreamnt
atgctgcaaactaaggatctcatctggactttgtttttcctgggaactgcagtttctctg
caggtggatattgttcccagccagggggagatcagcgttggagagtccaaattcttctta
tgccaagtggcaggagatgccaaagataaagacatctcctggttctcccccaatggagaa
aagctcaccccaaaccagcagcggatctcagtggtgtggaatgatgattcctcctccacc
ctcaccatctataacgccaacatcgacgacgccggcatttacaagtgtgtggttacaggc
gaggatggcagtgagtcagaggccaccgtcaacgtgaagatctttcagaagctcatgttc
aagaatgcgccaaccccacaggagttccgggagggggaagatgccgtgattgtgtgtgat
gtggtcagctccctcccaccaaccatcatctggaaacacaaaggccgagatgtcatcctg
aaaaaagatgtccgattcatagtcctgtccaacaactacctgcagatccggggcatcaag
aaaacagatgagggcacttatcgctgtgagggcagaatcctggcacggggggagatcaac
ttcaaggacattcaggtcattgtgaatgtgccacctaccatccaggccaggcagaatatt
gtgaatgccaccgccaacctcggccagtccgtcaccctggtgtgcgatgccgaaggcttc
ccagagcccaccatgagctggacaaaggatggggaacagatagagcaagaggaagacgat
gagaagtacatcttcagcgacgatagttcccagctgaccatcaaaaaggtggataagaac
gacgaggctgagtacatctgcattgctgagaacaaggctggcgagcaggatgcgaccatc
cacctcaaagtctttgcaaaacccaaaatcacatatgtagagaaccagactgccatggaa
ttagaggagcaggtcactcttacctgtgaagcctccggagaccccattccctccatcacc
tggaggacttctacccggaacatcagcagcgaagaaaaggcttcgtggactcgaccagag
aagcaagagactctggatgggcacatggtggtgcgtagccatgcccgtgtgtcgtcgctg
accctgaagagcatccagtacactgatgccggagagtacatctgcaccgccagcaacacc
atcggccaggactcccagtccatgtaccttgaagtgcaatatgccccaaagctacagggc
cctgtggctgtgtacacttgggaggggaaccaggtgaacatcacctgcgaggtatttgcc
tatcccagtgccacgatctcatggtttcgggatggccagctgctgccaagctccaattac
agcaatatcaagatctacaacaccccctctgccagctatctggaggtgaccccagactct
gagaatgattttgggaactacaactgtactgcagtgaaccgcattgggcaggagtccttg
gaattcatccttgttcaagcagacaccccctcttcaccatccatcgaccaggtggagcca
tactccagcacagcccaggtgcagtttgatgaaccagaggccacaggtggggtgcccatc
ctcaaatacaaagctgagtggagagcagttggtgaagaagtatggcattccaagtggtat
gatgccaaggaagccagcatggagggcatcgtcaccatcgtgggcctgaagcccgaaaca
acgtacgccgtaaggctggcggcgctcaatggcaaagggctgggtgagatcagcgcggcc
tccgagttcaagacgcagccagtccaaggggaacccagtgcacctaagctcgaagggcag
atgggagaggatggaaactctattaaagtgaacctgatcaagcaggatgacggcggctcc
cccatcagacactatctggtcaggtaccgagcgctctcctccgagtggaaaccagagatc
aggctcccgtctggcagtgaccacgtcatgctgaagtccctggactggaatgctgagtat
gaggtctacgtggtggctgagaaccagcaaggaaaatccaaggcggctcattttgtgttc
aggacctcggcccagcccacagccatcccagccaacggcagccccacctcaggcctgagc
accggggccatcgtgggcatcctcatcgtcatcttcgtcctgctcctggtggttgtggac
atcacctgctacttcctgaacaagtgtggcctgttcatgtgcattgcggtcaacctgtgt
ggaaaagccgggcccggggccaagggcaaggacatggaggagggcaaggccgccttctcg
aaagatgagtccaaggagcccatcgtggaggttcgaacggaggaggagaggaccccaaac
catgatggagggaaacacacagagcccaacgagaccacgccactgacggagcccgagaag
ggccccgtagaagcaaagccagagtgccaggagacagaaacgaagccagcgccagccgaa
gtcaagacggtccccaatgacgccacacagacaaaggagaacgagagcaaagcatga

KEGG   Homo sapiens (human): 4685
Entry
4685              CDS       T01001                                 

Gene name
NCAM2, NCAM21
Definition
(RefSeq) neural cell adhesion molecule 2
  KO
K06491  neural cell adhesion molecule
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules
hsa05020  Prion disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    4685 (NCAM2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    4685 (NCAM2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4685 (NCAM2)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:hsa04515]
    4685 (NCAM2)
   04090 CD molecules [BR:hsa04090]
    4685 (NCAM2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    4685 (NCAM2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    4685 (NCAM2)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    4685 (NCAM2)
Cell adhesion molecules [BR:hsa04515]
 Immunoglobulin superfamily
  NCAM1/2
   4685 (NCAM2)
CD molecules [BR:hsa04090]
 Proteins
  4685 (NCAM2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Adhesion molecules of cell surface
   4685 (NCAM2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  4685 (NCAM2)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Ig_C17orf99 Ig_5 Ig_4 Izumo-Ig Adeno_E3_CR1 Pur_ac_phosph_N Herpes_gE
Other DBs
NCBI-GeneID: 4685
NCBI-ProteinID: NP_004531
OMIM: 602040
HGNC: 7657
Ensembl: ENSG00000154654
Vega: OTTHUMG00000078121
Pharos: O15394(Tbio)
UniProt: O15394
LinkDB
Structure
PDB: 

Position
21q21.1
AA seq 837 aa
MSLLLSFYLLGLLVSSGQALLQVTISLSKVELSVGESKFFTCTAIGEPESIDWYNPQGEK
IISTQRVVVQKEGVRSRLTIYNANIEDAGIYRCQATDAKGQTQEATVVLEIYQKLTFREV
VSPQEFKQGEDAEVVCRVSSSPAPAVSWLYHNEEVTTISDNRFAMLANNNLQILNINKSD
EGIYRCEGRVEARGEIDFRDIIVIVNVPPAISMPQKSFNATAERGEEMTFSCRASGSPEP
AISWFRNGKLIEENEKYILKGSNTELTVRNIINSDGGPYVCRATNKAGEDEKQAFLQVFV
QPHIIQLKNETTYENGQVTLVCDAEGEPIPEITWKRAVDGFTFTEGDKSLDGRIEVKGQH
GSSSLHIKDVKLSDSGRYDCEAASRIGGHQKSMYLDIEYAPKFISNQTIYYSWEGNPINI
SCDVKSNPPASIHWRRDKLVLPAKNTTNLKTYSTGRKMILEIAPTSDNDFGRYNCTATNH
IGTRFQEYILALADVPSSPYGVKIIELSQTTAKVSFNKPDSHGGVPIHHYQVDVKEVASE
IWKIVRSHGVQTMVVLNNLEPNTTYEIRVAAVNGKGQGDYSKIEIFQTLPVREPSPPSIH
GQPSSGKSFKLSITKQDDGGAPILEYIVKYRSKDKEDQWLEKKVQGNKDHIILEHLQWTM
GYEVQITAANRLGYSEPTVYEFSMPPKPNIIKDTLFNGLGLGAVIGLGVAALLLILVVTD
VSCFFIRQCGLLMCITRRMCGKKSGSSGKSKELEEGKAAYLKDGSKEPIVEMRTEDERVT
NHEDGSPVNEPNETTPLTEPEKLPLKEEDGKEALNPETIEIKVSNDIIQSKEDDSKA
NT seq 2514 nt   +upstreamnt  +downstreamnt
atgagcctcctcctctccttctacctgctggggttgcttgtcagtagcgggcaagctctt
cttcaagtgacaatttcacttagcaaagtagagcttagtgttggagaatctaaattcttc
acatgtacagcgattggtgaacctgaaagtatagattggtataatcctcaaggagagaag
ataatttcaacacagagggtagtagtgcaaaaggaaggtgttaggtcacggttaaccatc
tacaatgcaaatatagaagatgcagggatatatcgttgtcaagcaacagatgccaaagga
caaacacaagaagctacagtagttttggaaatttaccaaaaactcactttcagagaagtg
gtatctccacaagaattcaaacaaggagaagatgcagaagtggtttgccgagttagcagt
tcacctgcacctgctgtcagctggttgtatcataatgaggaagtcaccactatttccgac
aatcggttcgctatgttagcaaacaataacctgcagattctcaacatcaataaaagtgat
gaaggtatatacagatgtgaaggaagagtggaggccaggggagaaattgacttccgtgat
atcattgttattgttaatgtgccgccagcaatctcaatgcctcagaaatcttttaatgcc
acagcagagagaggagaagaaatgacattttcctgcagggcctcaggctctccagaaccc
gccatctcctggttcaggaatggcaagctcattgaagaaaatgagaagtacatattgaaa
gggagcaatacagaactcactgtcaggaacataatcaatagtgatggtggtccttatgtc
tgcagggccacaaataaggcaggagaagatgaaaagcaagctttcctccaagtctttgta
cagcctcacataatacagcttaaaaatgaaactacatatgagaatggtcaagtcacactc
gtatgtgatgcggaaggggagcctattccagaaatcacttggaaaagagctgtggatggc
ttcacgttcactgaaggcgataagagcctggacggccgtatcgaagtcaaagggcagcat
ggaagctcatcactgcatattaaagatgtgaagttgtcagattcagggagatatgactgt
gaagctgcaagcagaattggagggcatcaaaagagcatgtaccttgatattgaatatgcc
cccaagtttatatcaaaccaaacaatttattactcttgggaaggaaatcctatcaatata
agttgtgatgtgaaatcgaatccaccagcatcaattcactggagaagagataaattagtc
ttacctgctaaaaacacgaccaatttaaagacttatagtacaggaagaaagatgatatta
gagattgcacctacatctgacaatgactttggacgctataattgcacagccactaatcat
ataggaacaagatttcaagaatatattcttgctttggctgacgtgccatccagtccctat
ggagtgaagatcatagagctgtcgcagaccacggccaaggtttccttcaacaaaccggac
tcccatggaggtgtacctattcatcactatcaggtggatgtcaaagaagtagcgtcagaa
atctggaaaattgtacgctcccatggagttcaaacaatggttgttttgaacaacctggaa
ccaaatacaacttatgaaatcagggttgcagctgtaaatggaaagggacaaggagactac
agtaaaatagaaatcttccaaacattaccagttcgtgaaccaagtcctccatccatacat
ggacagccaagcagtggaaagagctttaaactcagcatcaccaaacaggacgatggaggg
gcccctattttggaatacattgtgaaatatagaagtaaagataaggaagaccaatggcta
gagaaaaaagtgcaaggaaataaagaccacatcattttggagcatctccagtggaccatg
gggtatgaagttcagattacagctgccaatagattgggatattctgaaccgacagtttat
gaattcagcatgccaccaaagcccaacattattaaagacacgctgtttaatggtcttggg
cttggagcagtaattggcctgggagttgctgcactgctgctaattcttgtggtaacagac
gtcagctgcttctttattcggcaatgtgggttgctgatgtgcatcactaggagaatgtgt
ggaaagaaaagtggctccagtggcaaaagtaaagaactcgaagaaggaaaagctgcatac
ctgaaagatggatcaaaagaaccaatagtggagatgagaacagaggatgaaagagttact
aatcacgaagatgggagcccagtaaatgagccaaatgaaaccacaccactgacagaacct
gaaaaattgcctttaaaggaagaagatgggaaagaagctctaaatccagaaactatagaa
attaaagtttctaacgacatcattcaatcaaaagaagacgacagcaaagcataa

DBGET integrated database retrieval system