KEGG   Homo sapiens (human): 4690
Entry
4690              CDS       T01001                                 

Gene name
NCK1, NCK, NCKalpha, nck-1
Definition
(RefSeq) NCK adaptor protein 1
  KO
K07365  NCK adaptor protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04360  Axon guidance
hsa04660  T cell receptor signaling pathway
hsa05130  Pathogenic Escherichia coli infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01078  EGF-EGFR-Actin signaling pathway
N01092  Escherichia Eae/Tir to Actin signaling pathway
N01093  Escherichia EspJ/Tir to Actin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    4690 (NCK1)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    4690 (NCK1)
  09158 Development and regeneration
   04360 Axon guidance
    4690 (NCK1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    4690 (NCK1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    4690 (NCK1)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   4690 (NCK1)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 4690
NCBI-ProteinID: NP_001278928
OMIM: 600508
HGNC: 7664
Ensembl: ENSG00000158092
Vega: OTTHUMG00000159781
Pharos: P16333(Tbio)
UniProt: P16333 A0A0S2Z4Y3
LinkDB
Structure
PDB: 

Position
3q22.3
AA seq 377 aa
MAEEVVVVAKFDYVAQQEQELDIKKNERLWLLDDSKSWWRVRNSMNKTGFVPSNYVERKN
SARKASIVKNLKDTLGIGKVKRKPSVPDSASPADDSFVDPGERLYDLNMPAYVKFNYMAE
REDELSLIKGTKVIVMEKCSDGWWRGSYNGQVGWFPSNYVTEEGDSPLGDHVGSLSEKLA
AVVNNLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVG
LVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEMALNERG
HEGDFLIRDSESSPNDFSVSLKAQGKNKHFKVQLKETVYCIGQRKFSTMEELVEHYKKAP
IFTSEQGEKLYLVKHLS
NT seq 1134 nt   +upstreamnt  +downstreamnt
atggcagaagaagtggtggtagtagccaaatttgattatgtggcccaacaagaacaagag
ttggacatcaagaagaatgagagattatggcttctggatgattctaagtcctggtggcga
gttcgaaattccatgaataaaacaggttttgtgccttctaactatgtggaaaggaaaaac
agtgctcggaaagcatctattgtgaaaaacctaaaggataccttaggcattggaaaagtg
aaaagaaaacctagtgtgccagattctgcatctcctgctgatgatagttttgttgaccca
ggggaacgtctctatgacctcaacatgcccgcttatgtgaaatttaactacatggctgag
agagaggatgaattatcattgataaaggggacaaaggtgatcgtcatggagaaatgcagt
gatgggtggtggcgtggtagctacaatggacaagttggatggttcccttcaaactatgta
actgaagaaggtgacagtcctttgggtgaccatgtgggttctctgtcagagaaattagca
gcagtcgtcaataacctaaatactgggcaagtgttgcatgtggtacaggctctttaccca
ttcagctcatctaatgatgaagaacttaatttcgagaaaggagatgtaatggatgttatt
gaaaaacctgaaaatgacccagagtggtggaaatgcaggaagatcaatggtatggttggt
ctagtaccaaaaaactatgttaccgttatgcagaataatccattaacttcaggtttggaa
ccatcacctccacagtgtgattacattaggccttcactcactggaaagtttgctggcaat
ccttggtattatggcaaagtcaccaggcatcaagcagaaatggcattaaatgaaagagga
catgaaggggatttcctcattcgtgatagtgaatcttcgccaaatgatttctcagtatca
ctaaaagcacaagggaaaaacaagcattttaaagtccaactaaaagagactgtctactgc
attgggcagcgtaaattcagcaccatggaagaacttgtagaacattacaaaaaggcacca
atttttacaagtgaacaaggagaaaaattatatcttgtcaagcatttatcatga

KEGG   Homo sapiens (human): 8440
Entry
8440              CDS       T01001                                 

Gene name
NCK2, GRB4, NCKbeta
Definition
(RefSeq) NCK adaptor protein 2
  KO
K19862  NCK adaptor protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04360  Axon guidance
hsa04660  T cell receptor signaling pathway
hsa05130  Pathogenic Escherichia coli infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01078  EGF-EGFR-Actin signaling pathway
N01092  Escherichia Eae/Tir to Actin signaling pathway
N01093  Escherichia EspJ/Tir to Actin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    8440 (NCK2)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    8440 (NCK2)
  09158 Development and regeneration
   04360 Axon guidance
    8440 (NCK2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    8440 (NCK2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    8440 (NCK2)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   8440 (NCK2)
SSDB
Motif
Pfam: SH3_1 SH3_9 SH3_2 SH2 SH3_3 SH3_10 hSH3 SH2_2
Other DBs
NCBI-GeneID: 8440
NCBI-ProteinID: NP_001004720
OMIM: 604930
HGNC: 7665
Ensembl: ENSG00000071051
Vega: OTTHUMG00000153116
Pharos: O43639(Tbio)
UniProt: O43639 A0A0S2Z4M6
LinkDB
Structure
PDB: 

Position
2q12.2
AA seq 380 aa
MTEEVIVIAKWDYTAQQDQELDIKKNERLWLLDDSKTWWRVRNAANRTGYVPSNYVERKN
SLKKGSLVKNLKDTLGLGKTRRKTSARDASPTPSTDAEYPANGSGADRIYDLNIPAFVKF
AYVAEREDELSLVKGSRVTVMEKCSDGWWRGSYNGQIGWFPSNYVLEEVDEAAAESPSFL
SLRKGASLSNGQGSRVLHVVQTLYPFSSVTEEELNFEKGETMEVIEKPENDPEWWKCKNA
RGQVGLVPKNYVVVLSDGPALHPAHAPQISYTGPSSSGRFAGREWYYGNVTRHQAECALN
ERGVEGDFLIRDSESSPSDFSVSLKASGKNKHFKVQLVDNVYCIGQRRFHTMDELVEHYK
KAPIFTSEHGEKLYLVRALQ
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgacagaagaagttattgtgatagccaagtgggactacaccgcccagcaggaccaggag
ctggacatcaagaagaacgagcggctgtggttgctggacgactccaagacgtggtggcgg
gtgaggaacgcggccaacaggacgggctatgtaccgtccaactacgtggagcggaagaac
agcctgaagaagggctccctcgtgaagaacctgaaggacacactaggcctcggcaagacg
cgcaggaagaccagcgcgcgggatgcgtcccccacgcccagcacggacgccgagtacccc
gccaatggcagcggcgccgaccgcatctacgacctcaacatcccggccttcgtcaagttc
gcctatgtggccgagcgggaggatgagttgtccctggtgaaggggtcgcgcgtcaccgtc
atggagaagtgcagcgacggttggtggcggggcagctacaacgggcagatcggctggttc
ccctccaactacgtcttggaggaggtggacgaggcggctgcggagtccccaagcttcctg
agcctgcgcaagggcgcctcgctgagcaatggccagggctcccgcgtgctgcatgtggtc
cagacgctgtaccccttcagctcagtcaccgaggaggagctcaacttcgagaagggggag
accatggaggtgattgagaagccggagaacgaccccgagtggtggaaatgcaaaaatgcc
cggggccaggtgggcctcgtccccaaaaactacgtggtggtcctcagtgacgggcctgcc
ctgcaccctgcgcacgccccacagataagctacaccgggccctcgtccagcgggcgcttc
gcgggcagagagtggtactacgggaacgtgacgcggcaccaggccgagtgcgccctcaac
gagcggggcgtggagggcgacttcctcattagggacagcgagtcctcgcccagcgacttc
tccgtgtcccttaaagcgtcagggaagaacaaacacttcaaggtgcagctcgtggacaat
gtctactgcattgggcagcggcgcttccacaccatggacgagctggtggaacactacaaa
aaggcgcccatcttcaccagcgagcacggggagaagctctacctcgtcagggccctgcag
tga

DBGET integrated database retrieval system