KEGG   Homo sapiens (human): 4716Help
Entry
4716              CDS       T01001                                 

Gene name
NDUFB10, PDSW
Definition
(RefSeq) NADH:ubiquinone oxidoreductase subunit B10
  KO
K03966  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 10
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04714  Thermogenesis
hsa04723  Retrograde endocannabinoid signaling
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    4716 (NDUFB10)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    4716 (NDUFB10)
  09159 Environmental adaptation
   04714 Thermogenesis
    4716 (NDUFB10)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    4716 (NDUFB10)
   05012 Parkinson disease
    4716 (NDUFB10)
   05016 Huntington disease
    4716 (NDUFB10)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    4716 (NDUFB10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUFB10
Motif
Other DBs
NCBI-GeneID: 4716
NCBI-ProteinID: NP_004539
OMIM: 603843
HGNC: 7696
Ensembl: ENSG00000140990
Vega: OTTHUMG00000128709
Pharos: O96000(Tclin)
UniProt: O96000 A8K761
LinkDB All DBs
Structure
PDB: 

Position
16p13.3
AA seq 172 aa AA seqDB search
MPDSWDKDVYPEPPRRTPVQPNPIVYMMKAFDLIVDRPVTLVREFIERQHAKNRYYYYHR
QYRRVPDITECKEEDIMCMYEAEMQWKRDYKVDQEIINIMQDRLKACQQREGQNYQQNCI
KEVEQFTQVAKAYQDRYQDLGAYSSARKCLAKQRQRMLQERKAAKEAAAATS
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgccggacagctgggacaaggatgtgtaccctgagcccccgcgccgcacgccggtgcag
cccaatcccatcgtctacatgatgaaagcgttcgacctcatcgtggaccgacccgtgacc
ctcgtgagagaatttatagagcggcagcacgcaaagaacaggtattactactaccaccgg
cagtaccgccgcgtgccagacatcactgagtgcaaggaggaggacatcatgtgcatgtat
gaagccgaaatgcagtggaagagggactacaaagtcgaccaagaaattatcaacattatg
caggatcggctcaaagcctgtcagcagagggaaggacagaactaccagcagaactgtatc
aaggaagtggagcagttcacccaggtggccaaggcctaccaggaccgctatcaggacctg
ggggcctacagttctgccaggaagtgcctggccaaacagaggcagaggatgctgcaagag
agaaaagctgcaaaagaggccgccgctgccacctcctga

DBGET integrated database retrieval system