KEGG   Homo sapiens (human): 4734Help
Entry
4734              CDS       T01001                                 

Gene name
NEDD4, NEDD4-1, RPF1
Definition
(RefSeq) NEDD4 E3 ubiquitin protein ligase
  KO
K10591  E3 ubiquitin-protein ligase NEDD4 [EC:2.3.2.26]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04120  Ubiquitin mediated proteolysis
hsa04144  Endocytosis
hsa04530  Tight junction
hsa05169  Epstein-Barr virus infection
Network
nt06120  Calcium signaling (virus)
nt06165  Epstein-Barr virus (EBV)
  Element
N00488  EBV LMP2A to BCR signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    4734 (NEDD4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    4734 (NEDD4)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    4734 (NEDD4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    4734 (NEDD4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4734 (NEDD4)
   04121 Ubiquitin system [BR:hsa04121]
    4734 (NEDD4)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    4734 (NEDD4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     4734 (NEDD4)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    4734 (NEDD4)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  HECT type E3
   4734 (NEDD4)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Morphogenesis factors
    4734 (NEDD4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HECT WW
Motif
Other DBs
NCBI-GeneID: 4734
NCBI-ProteinID: NP_001271267
OMIM: 602278
HGNC: 7727
Ensembl: ENSG00000069869
Vega: OTTHUMG00000132015
Pharos: P46934(Tbio)
UniProt: P46934
LinkDB All DBs
Structure
PDB: 

Position
15q21.3
AA seq 1319 aa AA seqDB search
MAQSLRLHFAARRSNTYPLSETSGDDLDSHVHMCFKRPTRISTSNVVQMKLTPRQTALAP
LIKENVQSQERSSVPSSENVNKKSSCLQISLQPTRYSGYLQSSNVLADSDDASFTCILKD
GIYSSAVVDNELNAVNDGHLVSSPAICSGSLSNFSTSDNGSYSSNGSDFGSCASITSGGS
YTNSVISDSSSYTFPPSDDTFLGGNLPSDSTSNRSVPNRNTTPCEIFSRSTSTDPFVQDD
LEHGLEIMKLPVSRNTKIPLKRYSSLVIFPRSPSTTRPTSPTSLCTLLSKGSYQTSHQFI
ISPSEIAHNEDGTSAKGFLSTAVNGLRLSKTICTPGEVRDIRPLHRKGSLQKKIVLSNNT
PRQTVCEKSSEGYSCVSVHFTQRKAATLDCETTNGDCKPEMSEIKLNSDSEYIKLMHRTS
ACLPSSQNVDCQININGELERPHSQMNKNHGILRRSISLGGAYPNISCLSSLKHNCSKGG
PSQLLIKFASGNEGKVDNLSRDSNRDCTNELSNSCKTRDDFLGQVDVPLYPLPTENPRLE
RPYTFKDFVLHPRSHKSRVKGYLRLKMTYLPKTSGSEDDNAEQAEELEPGWVVLDQPDAA
CHLQQQQEPSPLPPGWEERQDILGRTYYVNHESRRTQWKRPTPQDNLTDAENGNIQLQAQ
RAFTTRRQISEETESVDNRESSENWEIIREDEATMYSNQAFPSPPPSSNLDVPTHLAEEL
NARLTIFGNSAVSQPASSSNHSSRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDER
GRSYYVDHNSRTTTWTKPTVQATVETSQLTSSQSSAGPQSQASTSDSGQQVTQPSEIEQG
FLPKGWEVRHAPNGRPFFIDHNTKTTTWEDPRLKIPAHLRGKTSLDTSNDLGPLPPGWEE
RTHTDGRIFYINHNIKRTQWEDPRLENVAITGPAVPYSRDYKRKYEFFRRKLKKQNDIPN
KFEMKLRRATVLEDSYRRIMGVKRADFLKARLWIEFDGEKGLDYGGVAREWFFLISKEMF
NPYYGLFEYSATDNYTLQINPNSGLCNEDHLSYFKFIGRVAGMAVYHGKLLDGFFIRPFY
KMMLHKPITLHDMESVDSEYYNSLRWILENDPTELDLRFIIDEELFGQTHQHELKNGGSE
IVVTNKNKKEYIYLVIQWRFVNRIQKQMAAFKEGFFELIPQDLIKIFDENELELLMCGLG
DVDVNDWREHTKYKNGYSANHQVIQWFWKAVLMMDSEKRIRLLQFVTGTSRVPMNGFAEL
YGSNGPQSFTVEQWGTPEKLPRAHTCFNRLDLPPYESFEELWDKLQMAIENTQGFDGVD
NT seq 3960 nt NT seq  +upstreamnt  +downstreamnt
atggcacaaagcttacgattgcactttgcagccagaagaagcaatacttaccctttgtca
gaaacctccggagatgacttggatagccatgttcacatgtgcttcaaaagaccaacacgg
atttcaacgtctaacgttgttcaaatgaagctgactcccagacagactgcactagctccg
ttaataaaggaaaacgttcagtctcaagaaagatcatctgttccctcatctgaaaatgtt
aataaaaagagcagctgtctacagatttcactacagccaacaaggtacagtggatatctt
cagtctagcaatgtcttagctgatagtgatgatgcttcgtttacttgtatcttgaaggat
ggtatttacagtagtgctgtggtcgataatgaattgaatgctgtgaatgatggtcacctt
gtaagcagtccagccatttgtagtggtagccttagtaacttttcaaccagtgataatggg
tcttacagcagcaacggtagtgattttgggtcatgtgcaagtatcacaagtggaggttca
tatactaacagtgtcatcagtgacagtagtagttatacttttccaccaagtgatgatact
tttttgggtggaaacttaccttctgacagcacctccaatagaagtgtgccaaacaggaat
actactccttgtgaaattttttcaagaagtacaagtacagatccttttgtccaggatgac
ttggaacatggattagagattatgaaattgccagtgagcaggaacacaaaaattccacta
aaacgttactcctccttagtcatttttcctaggagtccttcaactacccgaccgacttct
ccaacaagtctgtgtactcttctgagcaaaggatcctatcaaacttcacaccagtttatt
atttctcctagtgaaattgcacataatgaggatggcactagtgctaaaggatttctttca
acagctgtcaatggacttcggttatctaaaacaatttgtacccccggagaagtaagagac
atacggccgcttcacaggaagggctcgttacagaagaaaattgttctttcgaataatact
cccagacagactgtctgtgaaaagtcatctgaaggatattcttgtgtttcagtgcatttc
acccaacgaaaagcagctacattagactgtgaaacaacaaatggtgattgtaaaccagaa
atgtcagaaattaagcttaattctgattcagagtatattaagctcatgcataggacatct
gcatgtttgccatcctcccaaaatgtagattgtcaaataaatatcaatggagaattggaa
agaccacattcacagatgaacaaaaaccatggtattttacgaagaagtatttcattggga
ggagcttatccaaatatttcctgtctatccagccttaagcacaattgttctaaaggggga
ccatctcagttactcataaagtttgcatctggaaatgaaggtaaagtggataatttatca
agagacagcaacagagattgcacaaatgaactgtctaattcttgcaagacaagagatgat
ttcctaggtcaagtggatgttccactttatccattaccgacagaaaatccaagattggag
agaccatatacatttaaggattttgttcttcatccaagaagtcacaaatcaagagttaaa
ggttatctgagactaaaaatgacttatttacctaaaaccagtggctcagaagatgataat
gcagaacaggctgaggaattagagcctggctgggttgttttggaccaaccagatgctgct
tgccatttgcagcaacaacaagaaccttctcctctacctccagggtgggaagagaggcag
gatatccttggaaggacctattatgtaaaccatgaatctagaagaacacagtggaaaaga
ccaacccctcaggacaacctaacagatgctgagaatggcaacattcaactgcaagcacaa
cgtgcatttaccaccaggcggcagatatccgaggaaacagaaagtgttgacaaccgagag
tcttccgagaactgggaaattataagagaagatgaagccaccatgtatagcaaccaggcc
ttcccatcacctccaccgtcaagtaacttggatgttccaactcatcttgcagaagaattg
aatgccagactcaccatttttggaaattcagccgtgagccagccagcatcgagctcaaat
cattccagcagaagaggcagcttacaagcctatacttttgaggaacaacctacacttcct
gtgcttttgcctacttcatctggattaccaccaggttgggaagaaaaacaagatgaaaga
ggaagatcatattatgtagatcacaattccagaacgactacttggacaaagcccactgta
caggccacagtggagaccagtcagctgacctcaagccagagttctgcaggccctcaatca
caagcctccaccagtgattcaggccagcaggtgacccagccatctgaaattgagcaagga
ttccttcctaaaggctgggaagtccggcatgcaccaaatgggaggcctttctttattgac
cacaacactaaaaccaccacctgggaagatccaagattgaaaattccagcccatctgaga
ggaaagacatcacttgatacttccaatgatctagggcctttacctccaggatgggaagag
agaactcacacagatggaagaatcttctacataaatcacaatataaaaagaacacaatgg
gaagatcctcggttggagaatgtagcaataactggaccagcagtgccctactccagggat
tacaaaagaaagtatgagttcttccgaagaaagttgaagaagcagaatgacattccaaac
aaatttgaaatgaaacttcgccgagcaactgttcttgaagactcttaccggagaattatg
ggtgtcaagagagcagacttcctgaaggctcgactgtggattgagtttgatggtgaaaag
ggattggattatggaggagttgccagagaatggttcttcctgatctcaaaggaaatgttt
aacccttattatgggttgtttgaatattctgctacggacaattataccctacagataaat
ccaaactctggattgtgtaacgaagatcacctctcttacttcaagtttattggtcgggta
gctggaatggcagtttatcatggcaaactgttggatggttttttcatccgcccattttac
aagatgatgcttcacaaaccaataacccttcatgatatggaatctgtggatagtgaatat
tacaattccctaagatggattcttgaaaatgacccaacagaattggacctcaggtttatc
atagatgaagaactttttggacagacacatcaacatgagctgaaaaatggtggatcagaa
atagttgtcaccaataagaacaaaaaggaatatatttatcttgtaatacaatggcgattt
gtaaaccgaatccagaagcaaatggctgcttttaaagagggattctttgaactaatacca
caggatctcatcaaaatttttgatgaaaatgaactagagcttcttatgtgtggactggga
gatgttgatgtgaatgactggagggaacatacaaagtataaaaatggctacagtgcaaat
catcaggttatacagtggttttggaaggctgttttaatgatggattcagaaaaaagaata
agattacttcagtttgtcactggcacatctcgggtgcctatgaatggatttgctgaacta
tacggttcaaatggaccacagtcatttacagttgaacagtggggtactcctgaaaagctg
ccaagagctcatacctgttttaatcgcctggacttgccaccttatgaatcatttgaagaa
ttatgggataaacttcagatggcaattgaaaacacccagggctttgatggagttgattag

DBGET integrated database retrieval system