KEGG   Homo sapiens (human): 4756Help
Entry
4756              CDS       T01001                                 

Gene name
NEO1, IGDCC2, NGN, NTN1R2
Definition
(RefSeq) neogenin 1
  KO
K06766  neogenin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04350  TGF-beta signaling pathway
hsa04360  Axon guidance
hsa04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    4756 (NEO1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    4756 (NEO1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    4756 (NEO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig Pur_ac_phosph_N V-set Interfer-bind Ig_5 C2-set_2 fn3_2 Ig_4 Tissue_fac DUF4959 EphA2_TM SusE TMEM154 Ig_6 Shisa Herpes_UL74 Ly49 FAM176
Motif
Other DBs
NCBI-GeneID: 4756
NCBI-ProteinID: NP_002490
OMIM: 601907
HGNC: 7754
Ensembl: ENSG00000067141
Vega: OTTHUMG00000133509
Pharos: Q92859(Tbio)
UniProt: Q92859 Q59FP8
LinkDB All DBs
Structure
PDB: 

Position
15q24.1
AA seq 1461 aa AA seqDB search
MAAERGARRLLSTPSFWLYCLLLLGRRAPGAAAARSGSAPQSPGASIRTFTPFYFLVEPV
DTLSVRGSSVILNCSAYSEPSPKIEWKKDGTFLNLVSDDRRQLLPDGSLFISNVVHSKHN
KPDEGYYQCVATVESLGTIISRTAKLIVAGLPRFTSQPEPSSVYAGNNAILNCEVNADLV
PFVRWEQNRQPLLLDDRVIKLPSGMLVISNATEGDGGLYRCVVESGGPPKYSDEVELKVL
PDPEVISDLVFLKQPSPLVRVIGQDVVLPCVASGLPTPTIKWMKNEEALDTESSERLVLL
AGGSLEISDVTEDDAGTYFCIADNGNETIEAQAELTVQAQPEFLKQPTNIYAHESMDIVF
ECEVTGKPTPTVKWVKNGDMVIPSDYFKIVKEHNLQVLGLVKSDEGFYQCIAENDVGNAQ
AGAQLIILEHAPATTGPLPSAPRDVVASLVSTRFIKLTWRTPASDPHGDNLTYSVFYTKE
GIARERVENTSHPGEMQVTIQNLMPATVYIFRVMAQNKHGSGESSAPLRVETQPEVQLPG
PAPNLRAYAASPTSITVTWETPVSGNGEIQNYKLYYMEKGTDKEQDVDVSSHSYTINGLK
KYTEYSFRVVAYNKHGPGVSTPDVAVRTLSDVPSAAPQNLSLEVRNSKSIMIHWQPPAPA
TQNGQITGYKIRYRKASRKSDVTETLVSGTQLSQLIEGLDRGTEYNFRVAALTINGTGPA
TDWLSAETFESDLDETRVPEVPSSLHVRPLVTSIVVSWTPPENQNIVVRGYAIGYGIGSP
HAQTIKVDYKQRYYTIENLDPSSHYVITLKAFNNVGEGIPLYESAVTRPHTDTSEVDLFV
INAPYTPVPDPTPMMPPVGVQASILSHDTIRITWADNSLPKHQKITDSRYYTVRWKTNIP
ANTKYKNANATTLSYLVTGLKPNTLYEFSVMVTKGRRSSTWSMTAHGTTFELVPTSPPKD
VTVVSKEGKPKTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQ
ELTLDTPYYFKIQARNSKGMGPMSEAVQFRTPKADSSDKMPNDQASGSGGKGSRLPDLGS
DYKPPMSGSNSPHGSPTSPLDSNMLLVIIVSVGVITIVVVVIIAVFCTRRTTSHQKKKRA
ACKSVNGSHKYKGNSKDVKPPDLWIHHERLELKPIDKSPDPNPIMTDTPIPRNSQDITPV
DNSMDSNIHQRRNSYRGHESEDSMSTLAGRRGMRPKMMMPFDSQPPQPVISAHPIHSLDN
PHHHFHSSSLASPARSHLYHPGSPWPIGTSMSLSDRANSTESVRNTPSTDTMPASSSQTC
CTDHQDPEGATSSSYLASSQEEDSGQSLPTAHVRPSHPLKSFAVPAIPPPGPPTYDPALP
STPLLSQQALNHHIHSVKTASIGTLGRSRPPMPVVVPSAPEVQETTRMLEDSESSYEPDE
LTKEMAHLEGLMKDLNAITTA
NT seq 4386 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggagcggggagcccggcgactcctcagcaccccctccttctggctctactgc
ctgctgctgctcgggcgccgggcgccgggcgccgcggccgccaggagcggctccgcgccg
cagtccccaggagccagcattcgaacgttcactccattttattttctggtggagccggtg
gatacactctcagttagaggctcttctgttatattaaactgttcagcatattctgagcct
tctccaaaaattgaatggaaaaaagatggaacttttttaaacttagtatcagatgatcga
cgccagcttctcccggatggatctttatttatcagcaatgtggtgcattccaaacacaat
aaacctgatgaaggttattatcagtgtgtggccactgttgagagtcttggaactattatc
agtagaacagcgaagctcatagtagcaggtcttccaagatttaccagccaaccagaacct
tcctcagtttatgctgggaacaatgcaattctgaattgtgaagttaatgcagatttggtc
ccatttgtgaggtgggaacagaacagacaaccccttcttctggatgatagagttatcaaa
cttccaagtggaatgctggttatcagcaatgcaactgaaggagatggcgggctttatcgc
tgcgtagtggaaagtggtgggccaccaaagtatagtgatgaagttgaattgaaggttctt
ccagatcctgaggtgatatcagacttggtatttttgaaacagccttctcccttagtcaga
gtcattggtcaggatgtagtgttgccatgtgttgcttcaggacttcctactccaaccatt
aaatggatgaaaaatgaggaggcacttgacacagaaagctctgaaagattggtattgctg
gcaggtggtagcctggagatcagtgatgttactgaggatgatgctgggacttatttttgt
atagctgataatggaaatgagacaattgaagctcaagcagagcttacagtgcaagctcaa
cctgaattcctgaagcagcctactaatatatatgctcacgaatctatggatattgtattt
gaatgtgaagtgactggaaaaccaactccaactgtgaagtgggtcaaaaatggggatatg
gttatcccaagtgattattttaagattgtaaaggaacataatcttcaagttttgggtctg
gtgaaatcagatgaagggttctatcagtgcattgctgaaaatgatgttggaaatgcacaa
gctggagcccaactgataatccttgaacatgcaccagccacaacgggaccactgccttca
gctcctcgggatgtcgtggcctccctggtctctacccgcttcatcaaattgacgtggcgg
acacctgcatcagatcctcacggagacaaccttacctactctgtgttctacaccaaggaa
gggattgctagggaacgtgttgagaataccagtcacccaggagagatgcaagtaaccatt
caaaacctaatgccagcgaccgtgtacatctttagagttatggctcaaaataagcatggc
tcaggagagagttcagctccactgcgagtagaaacacaacctgaggttcagctccctggc
ccagcacctaaccttcgtgcatatgcagcttcgcctacctccatcactgttacgtgggaa
acaccagtgtctggcaatggggaaattcagaattataaattgtactacatggaaaagggg
actgataaagaacaggatgttgatgtttcaagtcactcttacaccattaatgggttgaaa
aaatatacagagtatagtttccgagtggtggcctacaataaacatggtcctggagtttcc
acaccagatgttgctgttcgaacattgtcagatgttcccagtgctgctcctcagaatctg
tccttggaagtgagaaattcaaagagtattatgattcactggcagccacctgctccagcc
acacaaaatgggcagattactggctacaagattcgctaccgaaaggcctcccgaaagagt
gatgtcactgagaccttggtaagcgggacacagctgtctcagctgattgaaggtcttgat
cgggggactgagtataatttccgagtggctgctctaacaatcaatggtacaggcccggca
actgactggctgtctgctgaaacttttgaaagtgacctagatgaaactcgtgttcctgaa
gtgcctagctctcttcacgtacgcccgctcgttactagcatcgtagtgagctggactcct
ccagagaatcagaacattgtggtcagaggttacgccattggttatggcattggcagccct
catgcccagaccatcaaagtggactataaacagcgctattacaccattgaaaatctggat
cccagctctcactatgtgattaccctgaaagcatttaataacgtgggtgaaggcatcccc
ctgtatgagagtgctgtgaccaggcctcacacagacacttctgaagttgatttatttgtt
attaatgctccatacactccagtgccagatcccactcccatgatgccaccagtgggagtt
caggcttccattctgagtcatgacaccatcaggattacgtgggcagacaactcgctgccc
aagcaccagaagattacagactcccgatactacaccgtccgatggaaaaccaacatccca
gcaaacaccaagtacaagaatgcaaatgcaaccactttgagttatttggtgactggttta
aagccgaatacactctatgaattctctgtgatggtgaccaaaggtcgaagatcaagtaca
tggagtatgacagcccatgggaccacctttgaattagttccgacttctccacccaaggat
gtgactgttgtgagtaaagaggggaaacctaagaccataattgtgaattggcagcctccc
tccgaagccaatggcaaaattacaggttacatcatatattacagtacagatgtgaatgca
gagatacatgactgggttattgagcctgttgtgggaaacagactgactcaccagatacaa
gagttaactcttgacacaccatactacttcaaaatccaggcacggaactcaaagggcatg
ggacccatgtctgaagctgtccaattcagaacacctaaagcggactcctctgataaaatg
cctaatgatcaagcctcagggtctggagggaaaggaagccggctgccagacctaggatcc
gactacaaacctccaatgagcggcagtaacagccctcatgggagccccacctctcctctg
gacagtaatatgctgctggtcataattgtttctgttggcgtcatcaccatcgtggtggtt
gtgattatcgctgtcttttgtacccgtcgtaccacctctcaccagaaaaagaaacgagct
gcctgcaaatcagtgaatggctctcataagtacaaagggaattccaaagatgtgaaacct
ccagatctctggatccatcatgagagactggagctgaaacccattgataagtctccagac
ccaaaccccatcatgactgatactccaattcctcgcaactctcaagatatcacaccagtt
gacaactccatggacagcaatatccatcaaaggcgaaattcatacagagggcatgagtca
gaggacagcatgtctacactggctggaaggcgaggaatgagaccaaaaatgatgatgccc
tttgactcccagccaccccagcctgtgattagtgcccatcccatccattccctcgataac
cctcaccatcatttccactccagcagcctcgcttctccagctcgcagtcatctctaccac
ccgggcagcccatggcccattggcacatccatgtccctttcagacagggccaattccaca
gaatccgttcgaaatacccccagcactgacaccatgccagcctcttcgtctcaaacatgc
tgcactgatcaccaggaccctgaaggtgctaccagctcctcttacttggccagctcccaa
gaggaagattcaggccagagtcttcccactgcccatgttcgcccttcccacccattgaag
agcttcgccgtgccagcaatcccgcctccaggacctcccacctatgatcctgcattgcca
agcacaccattactgtcccagcaagctctgaaccatcacattcactcagtgaagacagcc
tccatcgggactctaggaaggagccggcctcctatgccagtggttgttcccagtgcccct
gaagtgcaggagaccacaaggatgttggaagactccgagagtagctatgaaccagatgag
ctgaccaaagagatggcccacctggaaggactaatgaaggacctaaacgctatcacaaca
gcatga

DBGET integrated database retrieval system