KEGG   Homo sapiens (human): 4772Help
Entry
4772              CDS       T01001                                 

Gene name
NFATC1, NF-ATC, NF-ATc1.2, NFAT2, NFATc
Definition
(RefSeq) nuclear factor of activated T cells 1
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04380  Osteoclast differentiation
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05135  Yersinia infection
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05321  Inflammatory bowel disease (IBD)
Network
nt06120  Calcium signaling (virus)
nt06124  Chemokine signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06220  Calcium signaling
  Element
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00172  KSHV K15 to PLCG-calcineurin signaling pathway
N00180  KSHV K1 to PLCG-calcineurin signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
N00432  HIV gp120 to CXCR4-GNAQ-PLCB/G-calcineurin
N00487  BCR-PLCG-Calcineurin signaling pathway
N00490  HTLV-1 p12 to calcineurin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4772 (NFATC1)
   04310 Wnt signaling pathway
    4772 (NFATC1)
   04024 cAMP signaling pathway
    4772 (NFATC1)
   04022 cGMP-PKG signaling pathway
    4772 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    4772 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    4772 (NFATC1)
   04650 Natural killer cell mediated cytotoxicity
    4772 (NFATC1)
   04660 T cell receptor signaling pathway
    4772 (NFATC1)
   04658 Th1 and Th2 cell differentiation
    4772 (NFATC1)
   04659 Th17 cell differentiation
    4772 (NFATC1)
   04662 B cell receptor signaling pathway
    4772 (NFATC1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    4772 (NFATC1)
  09158 Development
   04380 Osteoclast differentiation
    4772 (NFATC1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    4772 (NFATC1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    4772 (NFATC1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    4772 (NFATC1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    4772 (NFATC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4772 (NFATC1)
   05170 Human immunodeficiency virus 1 infection
    4772 (NFATC1)
   05161 Hepatitis B
    4772 (NFATC1)
   05163 Human cytomegalovirus infection
    4772 (NFATC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    4772 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4772 (NFATC1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    4772 (NFATC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Motif
Other DBs
NCBI-GeneID: 4772
NCBI-ProteinID: NP_001265598
OMIM: 600489
HGNC: 7775
Ensembl: ENSG00000131196
Vega: OTTHUMG00000132897
Pharos: O95644(Tbio)
UniProt: O95644
LinkDB All DBs
Structure
PDB: 

Position
18q23
AA seq 943 aa AA seqDB search
MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASSNVSPALPLPT
AHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGYFLSSGHTRPDGAPALESPRI
EITSCLGLYHNNNQFFHDVEVEDVLPSSKRSPSTATLSLPSLEAYRDPSCLSPASSLSSR
SCNSEASSYESNYSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPST
SPRASVTEESWLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSW
LGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKVEPVGEDLGSP
PPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPKPLSPTSYMSPTLPALDWQLP
SHSGPYELRIEVQPKSHHRAHYETEGSRGAVKASAGGHPIVQLHGYLENEPLMLQLFIGT
ADDRLLRPHAFYQVHRITGKTVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLR
NSDIELRKGETDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEK
QSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDLCKPNSLVVEI
PPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPIIKTEPTDDYEPAPTCGPVSQ
GLSPLPRPYYSQQLAMPPDPSSCLVAGFPPCPQRSTLMPAAPGVSPKLHDLSPAAYTKGV
ASPGHCHLGLPQPAGEAPAVQDVPRPVATHPGSPGQPPPALLPQQVSAPPSSSCPPGLEH
SLCPSSPSPPLPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHE
DGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgccaagcaccagctttccagtcccttccaagtttccacttggccctgcggctgcggtc
ttcgggagaggagaaactttggggcccgcgccgcgcgccggcggcaccatgaagtcagcg
gaggaagaacactatggctatgcatcctccaacgtcagccccgccctgccgctccccacg
gcgcactccaccctgccggccccgtgccacaaccttcagacctccacaccgggcatcatc
ccgccggcggatcacccctcggggtacggagcagctttggacggtgggcccgcgggctac
ttcctctcctccggccacaccaggcctgatggggcccctgccctggagagtcctcgcatc
gagataacctcgtgcttgggcctgtaccacaacaataaccagtttttccacgatgtggag
gtggaagacgtcctccctagctccaaacggtccccctccacggccacgctgagtctgccc
agcctggaggcctacagagacccctcgtgcctgagcccggccagcagcctgtcctcccgg
agctgcaactcagaggcctcctcctacgagtccaactactcgtacccgtacgcgtccccc
cagacgtcgccatggcagtctccctgcgtgtctcccaagaccacggaccccgaggagggc
tttccccgcgggctgggggcctgcacactgctgggttccccgcggcactccccctccacc
tcgccccgcgccagcgtcactgaggagagctggctgggtgcccgctcctccagacccgcg
tccccttgcaacaagaggaagtacagcctcaacggccggcagccgccctactcaccccac
cactcgcccacgccgtccccgcacggctccccgcgggtcagcgtgaccgacgactcgtgg
ttgggcaacaccacccagtacaccagctcggccatcgtggccgccatcaacgcgctgacc
accgacagcagcctggacctgggagatggcgtccctgtcaagtcccgcaagaccaccctg
gagcagccgccctcagtggcgctcaaggtggagcccgtcggggaggacctgggcagcccc
ccgcccccggccgacttcgcgcccgaagactactcctctttccagcacatcaggaagggc
ggcttctgcgaccagtacctggcggtgccgcagcacccctaccagtgggcgaagcccaag
cccctgtcccctacgtcctacatgagcccgaccctgcccgccctggactggcagctgccg
tcccactcaggcccgtatgagcttcggattgaggtgcagcccaagtcccaccaccgagcc
cactacgagacggagggcagccggggggccgtgaaggcgtcggccggaggacaccccatc
gtgcagctgcatggctacttggagaatgagccgctgatgctgcagcttttcattgggacg
gcggacgaccgcctgctgcgcccgcacgccttctaccaggtgcaccgcatcacagggaag
accgtgtccaccaccagccacgaggccatcctctccaacaccaaagtcctggagatccca
ctcctgccggagaacagcatgcgagccgtcattgactgtgccggaatcctgaaactcaga
aactccgacattgaacttcggaaaggagagacggacatcgggaggaagaacacacgggta
cggctggtgttccgcgttcacgtcccgcaacccagcggccgcacgctgtccctgcaggtg
gcctccaaccccatcgaatgctcccagcgctcagctcaggagctgcctctggtggagaag
cagagcacggacagctatccggtcgtgggcgggaagaagatggtcctgtctggccacaac
ttcctgcaggactccaaggtcattttcgtggagaaagccccagatggccaccatgtctgg
gagatggaagcgaaaactgaccgggacctgtgcaagccgaattctctggtggttgagatc
ccgccatttcggaatcagaggataaccagccccgttcacgtcagtttctacgtctgcaac
gggaagagaaagcgaagccagtaccagcgtttcacctaccttcccgccaacgttccaatt
ataaaaacagaacccactgatgattatgagcctgctccaacctgtggaccggtgagccag
gggttaagtcctctcccaagaccatactacagccagcagctcgcgatgccacccgacccc
agctcctgcctcgtggccggcttcccgccctgtccgcagagaagcaccctgatgccagcg
gcccctggcgtgagccccaagctccacgacctttctcccgctgcctacaccaagggcgtt
gccagcccgggccactgtcacctcggactcccgcagccggccggagaggcccccgccgtc
caggacgtgcccaggccagtggccacgcaccccggctcgcccgggcagccacccccggcc
ctgctgccacagcaggtgagtgcgcctccaagcagtagctgcccccctggtctcgaacac
tcgctctgccccagcagcccctctcctccactcccgcctgccacccaagagccgacctgc
ctgcagccctgcagcccagcgtgcccgcccgccacgggccgcccgcagcacctgccgtcc
acggtccgcagggacgagtctccgactgccgggccacggctgctgccagaggtgcatgag
gacggtagtcctaatttggcccctattcctgtaacggtcaagcgagagcctgaagagttg
gaccagttgtacctggatgacgtaaatgaaataatacgaaatgacctctccagcacgagc
acccactcctag

DBGET integrated database retrieval system