KEGG   Homo sapiens (human): 4773Help
Entry
4773              CDS       T01001                                 

Gene name
NFATC2, NFAT1, NFATP
Definition
(RefSeq) nuclear factor of activated T cells 2
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04380  Osteoclast differentiation
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04921  Oxytocin signaling pathway
hsa05135  Yersinia infection
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06120  Calcium signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06220  Calcium signaling
  Element
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00172  KSHV K15 to PLCG-calcineurin signaling pathway
N00180  KSHV K1 to PLCG-calcineurin signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
N00432  HIV gp120 to CXCR4-GNAQ-PLCB/G-calcineurin
N00487  BCR-PLCG-Calcineurin signaling pathway
N00490  HTLV-1 p12 to calcineurin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    4773 (NFATC2)
   04370 VEGF signaling pathway
    4773 (NFATC2)
   04022 cGMP-PKG signaling pathway
    4773 (NFATC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    4773 (NFATC2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    4773 (NFATC2)
   04650 Natural killer cell mediated cytotoxicity
    4773 (NFATC2)
   04660 T cell receptor signaling pathway
    4773 (NFATC2)
   04658 Th1 and Th2 cell differentiation
    4773 (NFATC2)
   04659 Th17 cell differentiation
    4773 (NFATC2)
   04662 B cell receptor signaling pathway
    4773 (NFATC2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    4773 (NFATC2)
  09158 Development and regeneration
   04360 Axon guidance
    4773 (NFATC2)
   04380 Osteoclast differentiation
    4773 (NFATC2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    4773 (NFATC2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    4773 (NFATC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4773 (NFATC2)
   05170 Human immunodeficiency virus 1 infection
    4773 (NFATC2)
   05161 Hepatitis B
    4773 (NFATC2)
   05163 Human cytomegalovirus infection
    4773 (NFATC2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    4773 (NFATC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4773 (NFATC2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    4773 (NFATC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Motif
Other DBs
NCBI-GeneID: 4773
NCBI-ProteinID: NP_775114
OMIM: 600490
HGNC: 7776
Ensembl: ENSG00000101096
Vega: OTTHUMG00000032747
Pharos: Q13469(Tbio)
UniProt: Q13469
LinkDB All DBs
Structure
PDB: 

Position
20q13.2
AA seq 925 aa AA seqDB search
MNAPERQPQPDGGDAPGHEPGGSPQDELDFSILFDYEYLNPNEEEPNAHKVASPPSGPAY
PDDVLDYGLKPYSPLASLSGEPPGRFGEPDRVGPQKFLSAAKPAGASGLSPRIEITPSHE
LIQAVGPLRMRDAGLLVEQPPLAGVAASPRFTLPVPGFEGYREPLCLSPASSGSSASFIS
DTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTSLAEDSCLGRHSPVPR
PASRSSSPGAKRRHSCAEALVALPPGASPQRSRSPSPQPSSHVAPQDHGSPAGYPPVAGS
AVIMDALNSLATDSPCGIPPKMWKTSPDPSPVSAAPSKAGLPRHIYPAVEFLGPCEQGER
RNSAPESILLVPPTWPKPLVPAIPICSIPVTASLPPLEWPLSSQSGSYELRIEVQPKPHH
RAHYETEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRIT
GKTVTTTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNT
RVRLVFRVHIPESSGRIVSLQTASNPIECSQRSAHELPMVERQDTDSCLVYGGQQMILTG
QNFTSESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRTPVKVNFYV
INGKRKRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPTHGGLGSQPYYPQHPMVAESPSC
LVATMAPCQQFRTGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADA
HRSVLVHAGSQGQSSALLHPSPTNQQASPVIHYSPTNQQLRCGSHQEFQHIMYCENFAPG
TTRPGPPPVSQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNL
DQTYLDDVNEIIRKEFSGPPARNQT
NT seq 2778 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcccccgagcggcagccccaacccgacggcggggacgccccaggccacgagcct
gggggcagcccccaagacgagcttgacttctccatcctcttcgactatgagtatttgaat
ccgaacgaagaagagccgaatgcacataaggtcgccagcccaccctccggacccgcatac
cccgatgatgtcctggactatggcctcaagccatacagcccccttgctagtctctctggc
gagccccccggccgattcggagagccggatagggtagggccgcagaagtttctgagcgcg
gccaagccagcaggggcctcgggcctgagccctcggatcgagatcactccgtcccacgaa
ctgatccaggcagtggggcccctccgcatgagagacgcgggcctcctggtggagcagccg
cccctggccggggtggccgccagcccgaggttcaccctgcccgtgcccggcttcgagggc
taccgcgagccgctttgcttgagccccgctagcagcggctcctctgccagcttcatttct
gacaccttctccccctacacctcgccctgcgtctcgcccaataacggcgggcccgacgac
ctgtgtccgcagtttcaaaacatccctgctcattattcccccagaacctcgccaataatg
tcacctcgaaccagcctcgccgaggacagctgcctgggccgccactcgcccgtgccccgt
ccggcctcccgctcctcatcgcctggtgccaagcggaggcattcgtgcgccgaggccttg
gttgccctgccgcccggagcctcaccccagcgctcccggagcccctcgccgcagccctca
tctcacgtggcaccccaggaccacggctccccggctgggtacccccctgtggctggctct
gccgtgatcatggatgccctgaacagcctcgccacggactcgccttgtgggatccccccc
aagatgtggaagaccagccctgacccctcgccggtgtctgccgccccatccaaggccggc
ctgcctcgccacatctacccggccgtggagttcctggggccctgcgagcagggcgagagg
agaaactcggctccagaatccatcctgctggttccgcccacttggcccaagccgctggtg
cctgccattcccatctgcagcatcccagtgactgcatccctccctccacttgagtggccg
ctgtccagtcagtcaggctcttacgagctgcggatcgaggtgcagcccaagccacatcac
cgggcccactatgagacagaaggcagccgaggggctgtcaaagctccaactggaggccac
cctgtggttcagctccatggctacatggaaaacaagcctctgggacttcagatcttcatt
gggacagctgatgagcggatccttaagccgcacgccttctaccaggtgcaccgaatcacg
gggaaaactgtcaccaccaccagctatgagaagatagtgggcaacaccaaagtcctggag
atacccttggagcccaaaaacaacatgagggcaaccatcgactgtgcggggatcttgaag
cttagaaacgccgacattgagctgcggaaaggcgagacggacattggaagaaagaacacg
cgggtgagactggttttccgagttcacatcccagagtccagtggcagaatcgtctcttta
cagactgcatctaaccccatcgagtgctcccagcgatctgctcacgagctgcccatggtt
gaaagacaagacacagacagctgcctggtctatggcggccagcaaatgatcctcacgggg
cagaactttacatccgagtccaaagttgtgtttactgagaagaccacagatggacagcaa
atttgggagatggaagccacggtggataaggacaagagccagcccaacatgctttttgtt
gagatccctgaatatcggaacaagcatatccgcacacctgtaaaagtgaacttctacgtc
atcaatgggaagagaaaacgaagtcagcctcagcactttacctaccacccagtcccagcc
atcaagacggagcccacggatgaatatgaccccactctgatctgcagccccacccatgga
ggcctggggagccagccttactacccccagcacccgatggtggccgagtccccctcctgc
ctcgtggccaccatggctccctgccagcagttccgcacggggctctcatcccctgacgcc
cgctaccagcaacagaacccagcggccgtactctaccagcggagcaagagcctgagcccc
agcctgctgggctatcagcagccggccctcatggccgccccgctgtcccttgcggacgct
caccgctctgtgctggtgcacgccggctcccagggccagagctcagccctgctccacccc
tctccgaccaaccagcaggcctcgcctgtgatccactactcacccaccaaccagcagctg
cgctgcggaagccaccaggagttccagcacatcatgtactgcgagaatttcgcaccaggc
accaccagacctggcccgcccccggtcagtcaaggtcagaggctgagcccgggttcctac
cccacagtcattcagcagcagaatgccacgagccaaagagccgccaaaaacggacccccg
gtcagtgaccaaaaggaagtattacctgcgggggtgaccattaaacaggagcagaacttg
gaccagacctacttggatgatgttaatgaaattatcaggaaggagttttcaggacctcct
gccagaaatcagacgtaa

KEGG   Homo sapiens (human): 4775Help
Entry
4775              CDS       T01001                                 

Gene name
NFATC3, NF-AT4c, NFAT4, NFATX
Definition
(RefSeq) nuclear factor of activated T cells 3
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04625  C-type lectin receptor signaling pathway
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa04662  B cell receptor signaling pathway
hsa04921  Oxytocin signaling pathway
hsa05135  Yersinia infection
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06120  Calcium signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06220  Calcium signaling
  Element
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00172  KSHV K15 to PLCG-calcineurin signaling pathway
N00180  KSHV K1 to PLCG-calcineurin signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
N00432  HIV gp120 to CXCR4-GNAQ-PLCB/G-calcineurin
N00487  BCR-PLCG-Calcineurin signaling pathway
N00490  HTLV-1 p12 to calcineurin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    4775 (NFATC3)
   04310 Wnt signaling pathway
    4775 (NFATC3)
   04022 cGMP-PKG signaling pathway
    4775 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    4775 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    4775 (NFATC3)
   04660 T cell receptor signaling pathway
    4775 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    4775 (NFATC3)
   04659 Th17 cell differentiation
    4775 (NFATC3)
   04662 B cell receptor signaling pathway
    4775 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    4775 (NFATC3)
  09158 Development and regeneration
   04360 Axon guidance
    4775 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    4775 (NFATC3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    4775 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4775 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    4775 (NFATC3)
   05161 Hepatitis B
    4775 (NFATC3)
   05163 Human cytomegalovirus infection
    4775 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    4775 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4775 (NFATC3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    4775 (NFATC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Motif
Other DBs
NCBI-GeneID: 4775
NCBI-ProteinID: NP_775188
OMIM: 602698
HGNC: 7777
Ensembl: ENSG00000072736
Vega: OTTHUMG00000137555
Pharos: Q12968(Tbio)
UniProt: Q12968 B5B2S1
LinkDB All DBs
Position
16q22.1
AA seq 1075 aa AA seqDB search
MTTANCGAHDELDFKLVFGEDGAPAPPPPGSRPADLEPDDCASIYIFNVDPPPSTLTTPL
CLPHHGLPSHSSVLSPSFQLQSHKNYEGTCEIPESKYSPLGGPKPFECPSIQITSISPNC
HQELDAHEDDLQINDPEREFLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDAS
SCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEETWHQQYGLGHSLSPRQS
PCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHS
PRGSVTEDTWLNASVHGGSGLGPAVFPFQYCVETDIPLKTRKTSEDQAAILPGKLELCSD
DQGSLSPARETSIDDGLGSQYPLKKDSCGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL
DWPLPAHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQM
FIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGI
LKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPSGKVLSLQIASIPVECSQRSAQELP
HIEKYSINSCSVNGGHEMVVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIREKCQGAHI
VLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHREEIDLSSVPSLPV
PHPAQTQRPSSDSGCSHDSVLSGQRSLICSIPQTYASMVTSSHLPQLQCRDESVSKEQHM
IPSPIVHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPINAASSQEFDSVLFQQDATLSG
LVNLGCQPLSSIPFHSSNSGSTGHLLAHTPHSVHTLPHLQSMGYHCSNTGQRSLSSPVAD
QITGQPSSQLQPITYGPSHSGSATTASPAASHPLASSPLSGPPSPQLQPMPYQSPSSGTA
SSPSPATRMHSGQHSTQAQSTGQGGLSAPSSLICHSLCDPASFPPDGATVSIKPEPEDRE
PNFATIGLQDITLDDVNEIIGRDMSQISVSQGAGVSRQAPLPSPESLDLGRSDGL
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgacttcaaactcgtctttggcgag
gacggggcgccggcgccgccgcccccgggctcgcggcctgcagatcttgagccagatgat
tgtgcatccatttacatctttaatgtagatccacctccatctactttaaccacaccactt
tgcttaccacatcatggattaccgtctcactcttctgttttgtcaccatcgtttcagctc
caaagtcacaaaaactatgaaggaacttgtgagattcctgaatctaaatatagcccatta
ggtggtcccaaaccctttgagtgcccaagtattcaaattacatctatctctcctaactgt
catcaagaattagatgcacatgaagatgacctacagataaatgacccagaacgggaattt
ttggaaaggccttctagagatcatctctatcttcctcttgagccatcctaccgggagtct
tctcttagtcctagtcctgccagcagcatctcttctaggagttggttctctgatgcatct
tcttgtgaatcgctttcacatatttatgatgatgtggactcagagttgaatgaagctgca
gcccgatttacccttggatcccctctgacttctcctggtggctctccagggggctgccct
ggagaagaaacttggcatcaacagtatggacttggacactcattatcacccaggcaatct
ccttgccactctcctagatccagtgtcactgatgagaattggctgagccccaggccagcc
tcaggaccctcatcaaggcccacatccccctgtgggaaacggaggcactccagtgctgaa
gtttgttatgctgggtccctttcaccccatcactcacctgttccttcacctggtcactcc
cccaggggaagtgtgacagaagatacgtggctcaatgcttctgtccatggtgggtcaggc
cttggccctgcagtttttccatttcagtactgtgtagagactgacatccctctcaaaaca
aggaaaacttctgaagatcaagctgccatactaccaggaaaattagagctgtgttcagat
gaccaagggagtttatcaccagcccgggagacttcaatagatgatggccttggatctcag
tatcctttaaagaaagattcatgtggtgatcagtttctttcagttccttcaccctttacc
tggagcaaaccaaagcctggccacacccctatatttcgcacatcttcattacctccacta
gactggcctttaccagctcattttggacaatgtgaactgaaaatagaagtgcaacctaaa
actcatcatcgagcccattatgaaactgaaggtagccgaggggcagtaaaagcatctact
gggggacatcctgttgtgaagctcctgggctataacgaaaagccaataaatctacaaatg
tttattgggacagcagatgatcgatatttacgacctcatgcattttaccaggtgcatcga
atcactgggaagacagtcgctactgcaagccaagagataataattgccagtacaaaagtt
ctggaaattccacttcttcctgaaaataatatgtcagccagtattgattgtgcaggtatt
ttgaaactccgcaattcagatatagaacttcgaaaaggagaaactgatattggcagaaag
aatactagagtacgacttgtgtttcgtgtacacatcccacagcccagtggaaaagtcctt
tctctgcagatagcctctatacccgttgagtgctcccagcggtctgctcaagaacttcct
catattgagaagtacagtatcaacagttgttctgtaaatggaggtcatgaaatggttgtg
actggatctaattttcttccagaatccaaaatcatttttcttgaaaaaggacaagatgga
cgacctcagtgggaggtagaagggaagataatcagggaaaaatgtcaaggggctcacatt
gtccttgaagttcctccatatcataacccagcagttacagctgcagtgcaggtgcacttt
tatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttatacaccagtt
ttgatgaagcaagaacacagagaagagattgatttgtcttcagttccatctttgcctgtg
cctcatcctgctcagacccagaggccttcctctgattcagggtgttcacatgacagtgta
ctgtcaggacagagaagtttgatttgctccatcccacaaacatatgcatccatggtgacc
tcatcccatctgccacagttgcagtgtagagatgagagtgttagtaaagaacagcatatg
attccttctccaattgtacaccagccttttcaagtcacaccaacacctcctgtggggtct
tcctatcagcctatgcaaactaatgttgtgtacaatggaccaacttgtcttcctattaat
gctgcctctagtcaagaatttgattcagttttgtttcagcaggatgcaactctttctggt
ttagtgaatcttggctgtcaaccactgtcatccataccatttcattcttcaaattcaggc
tcaacaggacatctcttagcccatacacctcattctgtgcataccctgcctcatctgcaa
tcaatgggatatcattgttcaaatacaggacaaagatctctttcttctccagtggctgac
cagattacaggtcagccttcgtctcagttacaacctattacatatggtccttcacattca
gggtctgctacaacagcttccccagcagcttctcatcccttggctagttcaccgctttct
gggccaccatctcctcagcttcagcctatgccttaccaatctcctagctcaggaactgcc
tcatcaccgtctccagccaccagaatgcattctggacagcactcaactcaagcacaaagt
acgggccaggggggtctttctgcaccttcatccttaatatgtcacagtttgtgtgatcca
gcgtcatttccacctgatggggcaactgtgagcattaaacctgaaccagaagatcgagag
cctaactttgcaaccattggtctgcaggacatcactttagatgatgtgaacgagataatt
gggagagacatgtcccagatttctgtttcccaaggagcaggggtgagcaggcaggctccc
ctcccgagtcctgagtccctggatttaggaagatctgatgggctctaa

KEGG   Homo sapiens (human): 4776Help
Entry
4776              CDS       T01001                                 

Gene name
NFATC4, NF-AT3, NF-ATC4, NFAT3
Definition
(RefSeq) nuclear factor of activated T cells 4
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04625  C-type lectin receptor signaling pathway
hsa04921  Oxytocin signaling pathway
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06120  Calcium signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06220  Calcium signaling
  Element
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00172  KSHV K15 to PLCG-calcineurin signaling pathway
N00180  KSHV K1 to PLCG-calcineurin signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
N00432  HIV gp120 to CXCR4-GNAQ-PLCB/G-calcineurin
N00487  BCR-PLCG-Calcineurin signaling pathway
N00490  HTLV-1 p12 to calcineurin signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    4776 (NFATC4)
   04022 cGMP-PKG signaling pathway
    4776 (NFATC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    4776 (NFATC4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    4776 (NFATC4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    4776 (NFATC4)
  09158 Development and regeneration
   04360 Axon guidance
    4776 (NFATC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4776 (NFATC4)
   05170 Human immunodeficiency virus 1 infection
    4776 (NFATC4)
   05161 Hepatitis B
    4776 (NFATC4)
   05163 Human cytomegalovirus infection
    4776 (NFATC4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    4776 (NFATC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4776 (NFATC4)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    4776 (NFATC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Motif
Other DBs
NCBI-GeneID: 4776
NCBI-ProteinID: NP_004545
OMIM: 602699
HGNC: 7778
Ensembl: ENSG00000100968
Vega: OTTHUMG00000029351
Pharos: Q14934(Tbio)
UniProt: Q14934
LinkDB All DBs
Structure
PDB: 

Position
14q12
AA seq 902 aa AA seqDB search
MGAASCEDEELEFKLVFGEEKEAPPLGAGGLGEELDSEDAPPCCRLALGEPPPYGAAPIG
IPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGPGGGAGGAGGGRVLECPSIRITS
ISPTPEPPAALEDNPDAWGDGSPRDYPPPEGFGGYREAGGQGGGAFFSPSPGSSSLSSWS
FFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPEDPWSLYGPSPGG
RGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGSEPPPP
PPLPLARDPGSPGPFDYVGAPPAESIPQKTRRTSSEQAVALPRSEEPASCNGKLPLGAEE
SVAPPGGSRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGGGKVVSVQAASVPIECSQRSAQELPQVEAYSPSACSVRG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSR
PVQVYFYVSNGRRKRSPTQSFRFLPVICKEEPLPDSSLRGFPSASATPFGTDMDFSPPRP
PYPSYPHEDPACETPYLSEGFGYGMPPLYPQTGPPPSYRPGLRMFPETRGTTGCAQPPAV
SFLPRPFPSDPYGGRGSSFSLGLPFSPPAPFRPPPLPASPPLEGPFPSQSDVHPLPAEGY
NKVGPGYGPGEGAPEQEKSRGGYSSGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEP
PA
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgggggcggccagctgcgaggatgaggagctggaatttaagctggtgttcggggaggaa
aaggaggcccccccgctgggcgcggggggattgggggaagaactggactcagaggatgcc
ccgccatgctgccgtctggccttgggagagccccctccctatggcgctgcacctatcggt
attccccgacctccaccccctcggcctggcatgcattcgccaccgccgcgaccagccccc
tcacctggcacctgggagagccagcccgccaggtcggtgaggctgggaggaccaggaggg
ggtgctgggggtgctgggggtggccgtgttctcgagtgtcccagcatccgcatcacctcc
atctctcccacgccggagccgccagcagcgctggaggacaaccctgatgcctggggggac
ggctctcctagagattaccccccaccagaaggctttgggggctacagagaagcagggggc
cagggtgggggggccttcttcagcccaagccctggcagcagcagcctgtcctcgtggagc
ttcttctccgatgcctctgacgaggcagccctgtatgcagcctgcgacgaggtggagtct
gagctaaatgaggcggcctcccgctttggcctgggctccccgctgccctcgccccgggcc
tcccctcggccatggacccccgaagatccctggagcctgtatggtccaagccccggaggc
cgagggccagaggatagctggctactcctcagtgctcctgggcccaccccagcctccccg
cggcctgcctctccatgtggcaagcggcgctattccagctcgggaaccccatcttcagcc
tccccagctctgtcccgccgtggcagcctgggggaagaggggtctgagccacctccacca
cccccattgcctctggcccgggacccgggctcccctggtccctttgactatgtgggggcc
ccaccagctgagagcatccctcagaagacacggcggacttccagcgagcaggcagtggct
ctgcctcggtctgaggagcctgcctcatgcaatgggaagctgcccttgggagcagaggag
tctgtggctcctccaggaggttcccggaaggaggtggctggcatggactacctggcagtg
ccctccccactcgcttggtccaaggcccggattgggggacacagccctatcttcaggacc
tctgccctacccccactggactggcctctgcccagccaatatgagcagctggagctgagg
atcgaggtacagcctagagcccaccaccgggcccactatgagacagaaggcagccgtgga
gctgtcaaagctgcccctggcggtcaccccgtagtcaagctcctaggctacagtgagaag
ccactgaccctacagatgttcatcggcactgcagatgaaaggaacctgcggcctcatgcc
ttctatcaggtgcaccgtatcacaggcaagatggtggccacggccagctatgaagccgta
gtcagtggcaccaaggtgttggagatgactctgctgcctgagaacaacatggcggccaac
attgactgcgcgggaatcctgaagcttcggaattcagacattgagcttcggaagggtgag
acggacatcgggcgcaaaaacacacgtgtacggctggtgttccgggtacacgtgccccag
ggcggcgggaaggtcgtctcagtacaggcagcatcggtgcccatcgagtgctcccagcgc
tcagcccaggagctgccccaggtggaggcctacagccccagtgcctgctctgtgagagga
ggcgaggaactggtactgactggctccaacttcctgccagactccaaggtggtgttcatt
gagaggggtcctgatgggaagctgcaatgggaggaggaggccacagtgaaccgactgcag
agcaacgaggtgacgctgaccctgactgtccccgagtacagcaacaagagggtttcccgg
ccagtccaggtctacttttatgtctccaatgggcggaggaaacgcagtcctacccagagt
ttcaggtttctgcctgtgatctgcaaagaggagcccctaccggactcatctctgcggggt
ttcccttcagcatcggcaaccccctttggcactgacatggacttctcaccacccaggccc
ccctacccctcctatccccatgaagaccctgcttgcgaaactccttacctatcagaaggc
ttcggctatggcatgccccctctgtacccccagacggggcccccaccatcctacagaccg
ggcctgcggatgttccctgagactaggggtaccacaggttgtgcccaaccacctgcagtt
tccttccttccccgccccttccctagtgacccgtatggagggcggggctcctctttctcc
ctggggctgccattctctccgccagccccctttcggccgcctcctcttcctgcatcccca
ccgcttgaaggccccttcccttcccagagtgatgtgcatcccctacctgctgagggatac
aataaggtagggccaggctatggccctggggagggggctccggagcaggagaaatccagg
ggtggctacagcagcggcttccgagacagtgtccctatccagggtatcacgctggaggaa
gtgagtgagatcattggccgagacctgagtggcttccctgcacctcctggagaagagcct
cctgcctga

DBGET integrated database retrieval system