KEGG   Homo sapiens (human): 4776
Entry
4776              CDS       T01001                                 

Gene name
NFATC4, NF-AT3, NF-ATC4, NFAT3
Definition
(RefSeq) nuclear factor of activated T cells 4
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04022  cGMP-PKG signaling pathway
hsa04218  Cellular senescence
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04625  C-type lectin receptor signaling pathway
hsa04921  Oxytocin signaling pathway
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06120  Calcium signaling (viruses and bacteria)
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06161  Human immunodeficiency virus type 1 (HIV-1)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06165  Epstein-Barr virus (EBV)
nt06167  Human cytomegalovirus (HCMV)
nt06220  Calcium signaling
  Element
N00147  EGF-EGFR-PLCG-calcineurin signaling pathway
N00172  KSHV K15 to PLCG-calcineurin signaling pathway
N00180  KSHV K1 to PLCG-calcineurin signaling pathway
N00401  CXCR4-GNAQ-PLCB/G-calcineurin signaling pathway
N00402  HCMV US28 to GNAQ-PLCB/G-calcineurin signaling pathway
N00432  HIV gp120 to CXCR4-GNAQ-PLCB/G-calcineurin
N00487  BCR-PLCG-Calcineurin signaling pathway
N00490  HTLV-1 p12 to calcineurin signaling pathway
N01106  TCR-NFAT signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    4776 (NFATC4)
   04022 cGMP-PKG signaling pathway
    4776 (NFATC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    4776 (NFATC4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    4776 (NFATC4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    4776 (NFATC4)
  09158 Development and regeneration
   04360 Axon guidance
    4776 (NFATC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    4776 (NFATC4)
   05170 Human immunodeficiency virus 1 infection
    4776 (NFATC4)
   05161 Hepatitis B
    4776 (NFATC4)
   05163 Human cytomegalovirus infection
    4776 (NFATC4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    4776 (NFATC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    4776 (NFATC4)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    4776 (NFATC4)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 4776
NCBI-ProteinID: NP_004545
OMIM: 602699
HGNC: 7778
Ensembl: ENSG00000100968
Vega: OTTHUMG00000029351
Pharos: Q14934(Tbio)
UniProt: Q14934
LinkDB
Structure
PDB: 
2YRP

Position
14q12
AA seq 902 aa
MGAASCEDEELEFKLVFGEEKEAPPLGAGGLGEELDSEDAPPCCRLALGEPPPYGAAPIG
IPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGPGGGAGGAGGGRVLECPSIRITS
ISPTPEPPAALEDNPDAWGDGSPRDYPPPEGFGGYREAGGQGGGAFFSPSPGSSSLSSWS
FFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPEDPWSLYGPSPGG
RGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGSEPPPP
PPLPLARDPGSPGPFDYVGAPPAESIPQKTRRTSSEQAVALPRSEEPASCNGKLPLGAEE
SVAPPGGSRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGGGKVVSVQAASVPIECSQRSAQELPQVEAYSPSACSVRG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSR
PVQVYFYVSNGRRKRSPTQSFRFLPVICKEEPLPDSSLRGFPSASATPFGTDMDFSPPRP
PYPSYPHEDPACETPYLSEGFGYGMPPLYPQTGPPPSYRPGLRMFPETRGTTGCAQPPAV
SFLPRPFPSDPYGGRGSSFSLGLPFSPPAPFRPPPLPASPPLEGPFPSQSDVHPLPAEGY
NKVGPGYGPGEGAPEQEKSRGGYSSGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEP
PA
NT seq 2709 nt   +upstreamnt  +downstreamnt
atgggggcggccagctgcgaggatgaggagctggaatttaagctggtgttcggggaggaa
aaggaggcccccccgctgggcgcggggggattgggggaagaactggactcagaggatgcc
ccgccatgctgccgtctggccttgggagagccccctccctatggcgctgcacctatcggt
attccccgacctccaccccctcggcctggcatgcattcgccaccgccgcgaccagccccc
tcacctggcacctgggagagccagcccgccaggtcggtgaggctgggaggaccaggaggg
ggtgctgggggtgctgggggtggccgtgttctcgagtgtcccagcatccgcatcacctcc
atctctcccacgccggagccgccagcagcgctggaggacaaccctgatgcctggggggac
ggctctcctagagattaccccccaccagaaggctttgggggctacagagaagcagggggc
cagggtgggggggccttcttcagcccaagccctggcagcagcagcctgtcctcgtggagc
ttcttctccgatgcctctgacgaggcagccctgtatgcagcctgcgacgaggtggagtct
gagctaaatgaggcggcctcccgctttggcctgggctccccgctgccctcgccccgggcc
tcccctcggccatggacccccgaagatccctggagcctgtatggtccaagccccggaggc
cgagggccagaggatagctggctactcctcagtgctcctgggcccaccccagcctccccg
cggcctgcctctccatgtggcaagcggcgctattccagctcgggaaccccatcttcagcc
tccccagctctgtcccgccgtggcagcctgggggaagaggggtctgagccacctccacca
cccccattgcctctggcccgggacccgggctcccctggtccctttgactatgtgggggcc
ccaccagctgagagcatccctcagaagacacggcggacttccagcgagcaggcagtggct
ctgcctcggtctgaggagcctgcctcatgcaatgggaagctgcccttgggagcagaggag
tctgtggctcctccaggaggttcccggaaggaggtggctggcatggactacctggcagtg
ccctccccactcgcttggtccaaggcccggattgggggacacagccctatcttcaggacc
tctgccctacccccactggactggcctctgcccagccaatatgagcagctggagctgagg
atcgaggtacagcctagagcccaccaccgggcccactatgagacagaaggcagccgtgga
gctgtcaaagctgcccctggcggtcaccccgtagtcaagctcctaggctacagtgagaag
ccactgaccctacagatgttcatcggcactgcagatgaaaggaacctgcggcctcatgcc
ttctatcaggtgcaccgtatcacaggcaagatggtggccacggccagctatgaagccgta
gtcagtggcaccaaggtgttggagatgactctgctgcctgagaacaacatggcggccaac
attgactgcgcgggaatcctgaagcttcggaattcagacattgagcttcggaagggtgag
acggacatcgggcgcaaaaacacacgtgtacggctggtgttccgggtacacgtgccccag
ggcggcgggaaggtcgtctcagtacaggcagcatcggtgcccatcgagtgctcccagcgc
tcagcccaggagctgccccaggtggaggcctacagccccagtgcctgctctgtgagagga
ggcgaggaactggtactgactggctccaacttcctgccagactccaaggtggtgttcatt
gagaggggtcctgatgggaagctgcaatgggaggaggaggccacagtgaaccgactgcag
agcaacgaggtgacgctgaccctgactgtccccgagtacagcaacaagagggtttcccgg
ccagtccaggtctacttttatgtctccaatgggcggaggaaacgcagtcctacccagagt
ttcaggtttctgcctgtgatctgcaaagaggagcccctaccggactcatctctgcggggt
ttcccttcagcatcggcaaccccctttggcactgacatggacttctcaccacccaggccc
ccctacccctcctatccccatgaagaccctgcttgcgaaactccttacctatcagaaggc
ttcggctatggcatgccccctctgtacccccagacggggcccccaccatcctacagaccg
ggcctgcggatgttccctgagactaggggtaccacaggttgtgcccaaccacctgcagtt
tccttccttccccgccccttccctagtgacccgtatggagggcggggctcctctttctcc
ctggggctgccattctctccgccagccccctttcggccgcctcctcttcctgcatcccca
ccgcttgaaggccccttcccttcccagagtgatgtgcatcccctacctgctgagggatac
aataaggtagggccaggctatggccctggggagggggctccggagcaggagaaatccagg
ggtggctacagcagcggcttccgagacagtgtccctatccagggtatcacgctggaggaa
gtgagtgagatcattggccgagacctgagtggcttccctgcacctcctggagaagagcct
cctgcctga

DBGET integrated database retrieval system